KEGG   Candidatus Protochlamydia amoebophila: pc0085Help
Entry
pc0085            CDS       T00172                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:pcu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    pc0085
Enzymes [BR:pcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     pc0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAF22809
UniProt: Q6MF40
Position
complement(144259..144858)
Genome map
AA seq 199 aa AA seqDB search
MEILLATTNLHKIREFKEMCKAFAHLEILSLHQFPAYMCPEEVGTNFKENAISKAEHAAK
HLNRWVLADDSGLVVPRLSGKPGIYSRRFAGLEATDEENRKKLLLEMRQLINKEDRTAYY
ECCLALSSPTGLQKCVQGICEGFILNEARGRNGFGYDSLFVKNDYEKSFAEIDEAVKNRI
SHRRKAFERLSAFLENLRD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcttctggcaactactaatttgcataaaattcgtgaatttaaagaaatgtgc
aaagcttttgctcatctagaaattttatctcttcatcaatttccagcttacatgtgtcca
gaagaagtgggaactaattttaaagaaaacgctatttctaaagcggaacatgcagctaaa
cacctcaatagatgggttcttgctgatgattctggtttagttgttccccggttaagcgga
aaaccaggtatttattctcgtcggtttgctggattagaggcaactgatgaagaaaatcgt
aaaaaacttcttttagaaatgagacaactaataaataaagaagatcgtacagcttattat
gaatgttgtttagcgctgtcttctccaactggtttacaaaagtgcgttcagggaatttgt
gaagggtttattctcaatgaagctagaggacggaatggatttggatatgactcgttattt
gtaaaaaacgattacgaaaaatcttttgccgagatcgacgaagccgttaaaaaccgtatt
tctcatagaagaaaagcttttgaacgactctctgcatttttagaaaatcttcgggattaa

DBGET integrated database retrieval system