KEGG   Candidatus Protochlamydia amoebophila: pc0099Help
Entry
pc0099            CDS       T00172                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pcu  Candidatus Protochlamydia amoebophila
Brite
KEGG Orthology (KO) [BR:pcu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    pc0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAF22823
UniProt: Q6MF26
Position
161360..162775
Genome map
AA seq 471 aa AA seqDB search
MDTALLILILITGFYMAWSIGANDVANAMGTSVGSGSLTLRQAVLIAAVLEFCGAFFFGS
HVSKTVQSGIIDPDVFNYDPKLLVFGMLASLGSVGMWLQLASYFGWPVSTTHSIVGAIVG
FGTVFGGIKAVYWKEVCYIITSWIFSPILGGIIAYYIFSLLRKRIFYALNPLEETRRLTP
FLVFVVTIILAVVLIFEGLHNLNVEFSLTSKILMTLAIGLMGSFVSYLLVRRIPIIPQEK
LSVPYNSEALHSLEKVRKHLQRFRMKSAGEAQYTAGLLLEEVEALSKTFESKINTDHTHV
EYVQVEKIFAYLQIMTACMMAFAHGANDVANAIGPLSAAVAILTTGLFAVDAPVPTWALA
LGGSGIVIGLATWGWRVIETIGKKITELTASRGFAAEFGAATTIVIASRFGLPISTTHTL
VGAVLGVGFARGLEAVNLTTTRDILVSWIVTVPIGALLAIILIYPIQAIFG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatactgcgctactcattttgattttgatcaccggattttatatggcttggagcata
ggagctaatgatgttgccaatgctatgggaacatctgttggttcaggttcattaactttg
cgccaagctgttctgattgccgctgttttagaattttgcggcgcttttttctttggttcc
catgtttctaaaactgtgcaaagtgggattattgatccagatgtttttaattatgatccc
aaactgctagtttttggaatgcttgcttctttaggttctgtaggaatgtggcttcaatta
gcatcctattttggttggcctgtttcaacgacacattcaattgttggcgcgattgtaggc
tttggtactgtttttggagggataaaggccgtatactggaaagaagtgtgttatattatt
accagttggattttttctcctattttaggagggattattgcttactatattttttctctt
ttaagaaaaagaattttttatgctttaaatcctctggaagaaacgcgtcgtttaacacca
tttttagtttttgtggttaccattattctagctgtggttcttatttttgaagggctgcat
aatttaaatgtagaattttcgttaacaagtaaaattttgatgacacttgcgattggcttg
atgggttctttcgttagttatttattagtacgccgaattcctattattccccaagaaaaa
ctctctgttccttacaattctgaagctttacattctttggaaaaggttcgtaaacatctg
caaagatttagaatgaagtctgctggagaagctcaatacactgcaggattattattagaa
gaagtagaggccctttcaaaaacttttgaatcaaaaattaatacagatcatacacatgtt
gaatatgttcaagtggaaaaaatatttgcttatttgcaaattatgactgcttgtatgatg
gcttttgcacatggagctaatgatgttgctaatgctataggtcctttatcagctgcagta
gctattttgacaactggtttatttgctgtggatgctcccgttcctacttgggctcttgca
ttaggtggaagtggaattgttatagggttagcaacctgggggtggagagttattgagaca
attggaaaaaaaattacagaattaacagctagtcgaggttttgctgctgaatttggagcg
gctacaacaattgtcattgcttctaggtttggtttacctatttcaacaacgcacacgctt
gtgggtgctgttttgggagtggggtttgctagaggtcttgaagcagttaatttaacaacg
acccgtgatattttagtttcttggatcgtgacggttcctattggagctttgttagcaatt
atattgatttatccgatccaagcaatatttggataa

DBGET integrated database retrieval system