KEGG   Candidatus Protochlamydia amoebophila: pc1298Help
Entry
pc1298            CDS       T00172                                 

Gene name
sucC
Definition
(GenBank) probable succinate-CoA ligase (ADP-forming) beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcu  Candidatus Protochlamydia amoebophila
Pathway
pcu00020  Citrate cycle (TCA cycle)
pcu00640  Propanoate metabolism
pcu01100  Metabolic pathways
pcu01110  Biosynthesis of secondary metabolites
pcu01120  Microbial metabolism in diverse environments
pcu01130  Biosynthesis of antibiotics
pcu01200  Carbon metabolism
Module
pcu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    pc1298 (sucC)
   00640 Propanoate metabolism
    pc1298 (sucC)
   00660 C5-Branched dibasic acid metabolism
    pc1298 (sucC)
Enzymes [BR:pcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     pc1298 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A RimK ATP-grasp Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: CAF24022
UniProt: Q6MBM7
Position
complement(1554249..1555418)
Genome map
AA seq 389 aa AA seqDB search
MNTHEFQAKQILRKYGIPVPDFYIASSSKEVEEIIKQYQLQSAIIKVQVHAGGRGKAGGV
KLATNPQEILEFSQELIGKKIINEQTGPSGMISHQVLISPAILIKKEFYLGITINRELAS
RVLIASPIGGVNIEKIAHEQPNQLLMLPIPLEETFRSYHLIRIASFMGWKGKQIQEGVAI
IQSLVKAFKETDASLLEINPLVETKEGHLLALDAKLSIDDNALFKHEDLKTLFDPSQMSN
NEARAQQFELAYVALEGEIGCMVNGAGLAMATMDLIQYHGGRPANFLDVGGGASQVKVAE
GFRIILSDSNVKAILINIFGGIMNCETLASGIIEAAKGLQIHIPLIVRMEGTNVEKGKQL
LQQSGLKILITENLTEAAQQAVQLAQSVR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacacgagtttcaagccaagcagattttacgtaagtatggcattcccgttcct
gatttttatatcgcttcttcttcgaaagaagtggaagagatcattaagcaataccaattg
caaagtgctatcatcaaagtacaggtgcatgccggaggacgtggaaaagccggtggagtc
aagttagcgacaaatccgcaagaaatcttagaattttcccaagaactcatcggaaaaaaa
atcattaatgaacagacaggccctagcggaatgatttctcatcaagttttgatttcccct
gctattttgattaaaaaagaattctatttaggaatcactattaatcgtgaattggcaagc
cgtgttttaatcgcttctcctattggaggagtaaacattgaaaaaattgctcacgaacaa
cctaatcaattgttaatgcttccaattcctttggaggaaacatttagatcttatcattta
attcgcattgcaagctttatgggatggaagggaaaacaaattcaagagggggttgcaatt
attcaatctcttgtgaaagcttttaaagaaacggatgcttctctacttgaaattaaccct
cttgtggaaacaaaggaaggccatttattagcgctggacgcgaagttatcaattgatgac
aatgctctttttaaacatgaggacttgaaaaccttattcgatccttcacaaatgtctaat
aatgaagcaagagctcagcaatttgaacttgcctatgttgctttagaaggggaaattggt
tgtatggtcaatggagctggattagccatggctacaatggaccttattcaataccatgga
ggacgtcctgctaactttttggatgtaggaggtggggcatcgcaagttaaagtggcagaa
ggatttagaattattctatcggattctaatgtgaaagccattttaattaacatctttggg
ggaattatgaattgtgaaacgttagcctcaggaattatcgaagcagctaaaggattacaa
attcatattcccttaattgtaagaatggagggaacaaatgtcgaaaaagggaagcaactt
cttcaacaatcaggcttaaagattttaattacagaaaatttgacagaagcagctcaacaa
gcagttcaattagcacaatcagtaaggtga

DBGET integrated database retrieval system