KEGG   Candidatus Protochlamydia amoebophila: pc1423Help
Entry
pc1423            CDS       T00172                                 

Gene name
traE
Definition
(GenBank) putative F pilus assembly protein traE
  KO
K12067  conjugal transfer pilus assembly protein TraE
Organism
pcu  Candidatus Protochlamydia amoebophila
Brite
KEGG Orthology (KO) [BR:pcu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pcu02044]
    pc1423 (traE)
Secretion system [BR:pcu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   pc1423 (traE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraE RasGAP_C
Motif
Other DBs
NCBI-ProteinID: CAF24147
UniProt: Q6MBA2
Position
1698071..1698640
Genome map
AA seq 189 aa AA seqDB search
MERIFFERNLNHLLVQRNFLVGLSLTLLMGVILAVSFLCFKTERIIIVPSTIEKEFWVDA
HSVSATYLEQFGLFLGQLLLTKSSYSADLHRNILCRHTEPQYLALLKQRLMEEEETLKKQ
NASYVFYLNNVHVNPKELTVTLLGDRQFFLAGQQTTLESCGYTLHFNYSGARLLLKGITQ
EKTDLARRA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaacggattttttttgaacgcaatctcaatcatttattagtgcagagaaacttttta
gtgggattgtcgttaaccttactgatgggagtgatcttagctgtctccttcctttgcttc
aaaacagaaagaattattattgtcccttcaacgattgaaaaagaattttgggttgatgct
cattccgtttcagccacctatctcgaacaatttggattgtttttagggcaactcttgctc
accaaatcttcttattctgcagatttacaccgcaatattttgtgtcgacataccgagcct
cagtatcttgctttattaaaacaaagattaatggaagaagaggagactttaaagaaacaa
aacgcttcttacgttttttacttaaataatgttcacgtcaatcccaaagaattaacggtg
actttgctcggagatcggcaatttttccttgcaggtcagcaaaccaccttggaaagctgc
ggctataccttgcatttcaattacagcggagctcgccttcttctaaaggggatcactcaa
gaaaaaaccgaccttgcgaggagagcctag

DBGET integrated database retrieval system