KEGG   Candidatus Protochlamydia amoebophila: pc1869Help
Entry
pc1869            CDS       T00172                                 

Definition
(GenBank) putative phosphoglycerate mutase
Organism
pcu  Candidatus Protochlamydia amoebophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAF24593
UniProt: Q6MA06
Position
2228252..2228899
Genome map
AA seq 215 aa AA seqDB search
MVDKNLFCDIYLIRHGETDWNMLGKLQGHIDISLNSSGKIQARNLQKQLNHINFAAAFSS
DLSRARQTAEIVLESKDIKIEETAVLRERQLGEWEGQSIDDLKNWLQKNSQIDSFTQEDF
LAYKWDSISENYAEVFNRLSRLVLKISPLYLGSTILLSSHGGLLRSVLYQLDFKSELRWH
VDNCGFIKIRANNRGGMTIAECHGIKTSRASSSTF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaaaatttattttgcgatatttatttaatccggcatggagagacagattgg
aacatgttaggaaaattacaagggcatattgatatttctcttaacagctcaggtaagatt
caagctcggaaccttcaaaagcaactgaatcacattaattttgcagcagctttttcctct
gatcttagccgagcgcgtcaaacggcagaaattgttctcgaatcaaaagacattaagata
gaggaaacagctgttttaagagagcgacagctaggcgaatgggaaggtcaatcaatagat
gacctaaaaaattggttgcaaaagaacagtcaaattgattctttcactcaagaagatttt
ttagcctacaagtgggattcaatatctgaaaactatgcagaagtattcaaccgtttgtct
aggcttgttttaaagatctctccattgtacttaggctctacaattttgctgtcttcccac
ggaggattattacgctcagttctttatcagttggattttaaaagtgaactcagatggcat
gtagataattgtggatttattaaaatacgtgccaataatagaggtggaatgactattgcg
gaatgtcatgggattaagacctcaagagcctcctcttcaacattttga

DBGET integrated database retrieval system