KEGG   Pectobacterium carotovorum subsp. odoriferum: BCS7_04970Help
Entry
BCS7_04970        CDS       T03424                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pcv  Pectobacterium carotovorum subsp. odoriferum
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pcv03016]
    BCS7_04970
Enzymes [BR:pcv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BCS7_04970
Transfer RNA biogenesis [BR:pcv03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BCS7_04970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIU90436
Position
1134514..1135302
Genome map
AA seq 262 aa AA seqDB search
MLEIIYQDEHLVAVNKPSGWLVHRSWLDRKEKVVVMQTVRDQIGQHVYTVHRLDRPTSGV
LLLALSSEVARALSQQFESHQMQKMYHAVVRGYVLDDGVIDYALTEELDKIADKFTNPDK
APQPAVTHYRSLAQVEMPVAIGRYPTARYSLMELKPQTGRKHQLRRHMSHIHHPIIGDTA
HGDLRHNRGMESHFSCGRLMLHASELQLNHPVSGQPLTLQARWDVPWQGVMTQFGWKGIL
PEFEGVEFPADSGQDSEHFVEQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagattatttatcaggatgagcatctggttgccgtcaataaacccagcggctgg
ttagtccatcgtagctggctggatcgcaaagaaaaagtcgtggtgatgcagaccgtgcgc
gatcagatcggtcagcacgtgtataccgttcatcgtctcgacaggccgacatccggcgtg
ttgctgctcgcgctgtccagcgaggtggcgcgtgcgttatcccagcagtttgaatcgcat
cagatgcagaaaatgtatcatgccgttgtgcggggctatgtgctggatgacggcgtgatt
gactatgcgctcaccgaagagctggataagatcgccgacaagtttaccaatcctgataag
gcgccacagcctgccgtcacgcattaccgttctttggcgcaggtcgaaatgccggtcgcc
atcggccgttaccccacagcacgctacagtctgatggaactgaagccacagaccggacgc
aagcaccaactccgccgccatatgtcacatattcaccatcccattatcggcgataccgca
cacggcgacctgcgacacaatcgtggcatggagtcgcacttctcctgtggcaggctcatg
ctgcatgccagcgagttgcagctgaatcatccggtgagcgggcagccattgacgttgcag
gcgcgttgggatgtgccgtggcagggcgtgatgacacagtttggttggaaggggattctc
cctgagtttgaaggggttgagtttcctgccgactcaggtcaggatagcgagcatttcgtc
gagcagtaa

DBGET integrated database retrieval system