KEGG   Pectobacterium carotovorum subsp. odoriferum: BCS7_07045Help
Entry
BCS7_07045        CDS       T03424                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pcv  Pectobacterium carotovorum subsp. odoriferum
Pathway
pcv00561  Glycerolipid metabolism
pcv00640  Propanoate metabolism
pcv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCS7_07045
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BCS7_07045
Enzymes [BR:pcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BCS7_07045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AIU87930
UniProt: A0A094RGA4
Position
complement(1631634..1632737)
Genome map
AA seq 367 aa AA seqDB search
MIAIQAPQTYLNRDGVIRSVGEYAAPYASTVLIITSPQAWKTTSDAVERSLSDYGLGYQV
EFLPGDCTKPAIEALTAQARTFGAELILGIGGGRVLDVAKAVGDILGQIPVIAVPTIAAT
CAAWSPISVIYSDSGAHNGAFPLTRLPVWVLVDSEIIAHSPSRYLRAGIVDALAKWYEFQ
PYLRHGDSELALALKAQAARLAVETFNTYGEQAIADNEQGLVTPALRSAIDAVIALAGLA
NSMKDEVPRIGVAHAIHNSMTRLPELHDWLHGEKVGFGLATQAFLEHDNDADREELFAQL
RRYGSPITLSALGLNERPQLVEHIAQNVKIAPKIAARLPFATDAERIEQALWRTQTLEAS
VIDSHAA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaatacaagcgccacaaacctacctgaatcgtgatggcgtcattcgttctgtc
ggcgaatatgcagcgccttacgccagcacagtattaattattaccagcccacaggcatgg
aaaacgacgtcggatgcggtcgaacgcagcctcagtgattacggcttagggtatcaggtc
gaatttttgccgggtgattgcaccaagccagcgatagaagcgctgaccgcacaggcacga
acattcggcgcagaactgattttaggcattggcggcgggcgcgtgctggatgtcgccaaa
gccgtcggcgatattctgggacaaattcccgtcatcgctgtccccaccattgccgcaacc
tgcgccgcctggtcaccgatcagcgtgatatacagtgacagcggtgcacacaacggggca
tttccgctaacgcgcttacccgtgtgggtgctggtagacagcgagatcatcgcccacagc
ccttcacgctatctcagagccggcatcgtggatgcactggcgaagtggtacgaatttcag
ccctatttgcgtcacggcgatagcgaattggcattggcgcttaaagcgcaggctgcacgg
ctggccgtagagacatttaatacgtatggcgagcaggccatcgcggataatgagcaaggt
ctggtcacgccagccctgcgcagcgcgatcgacgccgttatcgcattggcgggtctggca
aatagcatgaaagatgaggtgccacgtattggtgtcgcccatgcgattcacaacagcatg
acacgcctgccggaactgcatgactggctgcacggcgagaaagtgggctttggtctggct
acacaggcgtttctggaacacgataacgacgccgaccgcgaagagctgttcgctcagctg
cgccgctacggtagcccgatcacgctaagtgccctcggcctaaacgaacgtccacagctg
gttgaacacatcgcgcagaacgtcaaaatcgcgccgaaaattgccgcacgcctgcctttt
gcaacggatgccgaacgtattgaacaggcgctatggcgcacacaaaccttagaagccagc
gtgatagatagccacgcagcatga

DBGET integrated database retrieval system