KEGG   Pectobacterium odoriferum: BCS7_09925Help
Entry
BCS7_09925        CDS       T03424                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
pcv  Pectobacterium odoriferum
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pcv03009]
    BCS7_09925
Enzymes [BR:pcv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BCS7_09925
Ribosome biogenesis [BR:pcv03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BCS7_09925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_32 Ubie_methyltran Methyltransf_29 MTS MetW NodS Methyltransf_33 Methyltransf_4 CheR PCMT Methyltransf_18 tRNA_U5-meth_tr CMAS Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: AIU88423
UniProt: A0A094S661
Position
2239853..2240683
Genome map
AA seq 276 aa AA seqDB search
MSYQCPLCQLPLERHPRQWTCGKHSFDCAKEGYVNLLPVQFKRSKQPGDSAEMMQARRSF
LEAGHYQPLRDAVAQHVDRIVADDAAALLDIGCGEGYYTAELAQRLTSCRTMTIYGLDVS
KAAIQRAAKRYDNVEFCVASSQRLPFQDRSLDTVVKIYAPCNDAELQRTVKVGGWVVTVS
PGPRHLYQLKAEVYDEVLLHPSKDEVLAGFQLMDQQTLAYPMQLSGNEAAALLQMTPFAW
RATPDVSERLQAAAAFRCETDFIIRLHQRVDSGAAA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcagtgtccgctatgccagttacctctggagcgacacccgcggcaatggacg
tgtggtaaacatagctttgactgtgcgaaagaagggtacgttaacctgttgccagtacag
tttaagcgttcaaaacagcctggtgatagtgctgaaatgatgcaggcgcgtcgcagcttt
ctggaagcgggtcactatcaaccgctacgcgacgccgtggcgcagcacgttgatcgtatt
gtggcggatgacgctgcggcgctgctggatatcggctgtggcgaagggtattacaccgcc
gaactggcccagcgtctcacatcgtgcagaacgatgacgatatacgggctggatgtttcc
aaagcggcaattcagcgcgcggcaaaacggtatgataacgttgagttttgcgtcgcctcc
agccagcggttgccttttcaagaccgctctcttgatactgtggtaaaaatttatgcgccg
tgtaatgacgcggaattgcagcgtaccgttaaggttggcggttgggtggtgacggtgtcg
ccggggccacgacacctttatcaactgaaagcggaagtctacgatgaggtgttattacac
ccgagcaaagatgaagtactcgcaggttttcagcttatggatcagcaaacgctcgcgtat
ccgatgcagttatctgggaatgaagctgcggcgctattgcaaatgacgccttttgcctgg
cgagcaacgccagacgttagcgagcgactgcaggcggctgccgcgtttcgttgtgaaacg
gactttattatccgcttgcatcagcgtgttgacagcggtgcggcagcctaa

DBGET integrated database retrieval system