KEGG   Pectobacterium odoriferum: BCS7_12390Help
Entry
BCS7_12390        CDS       T03424                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcv  Pectobacterium odoriferum
Pathway
pcv00480  Glutathione metabolism
pcv00590  Arachidonic acid metabolism
pcv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BCS7_12390 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCS7_12390 (btuE)
Enzymes [BR:pcv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BCS7_12390 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AIU88821
UniProt: A0A094S1Y9
Position
complement(2811382..2811933)
Genome map
AA seq 183 aa AA seqDB search
MSTEIYTIPLTTIDGKATTFEAFKGQVALVVNVASQCGLTKQYDALEKLYETYRDKGLVV
LGFPSNEFAGQEPGSEEEIQEFCRGTFGVQFPMFSKIEVNGENRHPLYQLLIRQQPEANG
TWKSDFFARLVNKGRKPKNPEDVLWNFEKFLVDREGQVIDRFAPDMAPDHDTIVKAIEEA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaatctatactattccgctgaccaccatcgacgggaaagcgacaacgttt
gaagcgtttaaagggcaggtggctttagtcgtcaatgtcgcctctcaatgcggcctgact
aaacaatacgacgcgttggaaaaactctacgaaacctatcgcgacaaaggtctggtcgtg
ctgggattcccctccaatgaatttgcagggcaggaaccgggctcggaagaagagattcag
gaattctgccgtgggacatttggcgttcagttcccgatgttcagcaaaattgaagtgaat
ggcgagaaccgtcacccgctgtaccagttgttgattcgtcagcaaccggaagccaatgga
acctggaaaagtgacttttttgcgcgtttagttaataaaggccgtaaacccaagaatcca
gaagacgttctgtggaatttcgaaaaattcctggtggatcgcgaagggcaggtgattgat
cgctttgcgccggatatggcacctgaccatgacaccatcgtgaaagcgatcgaagaggcg
ttggcaaaataa

DBGET integrated database retrieval system