KEGG   Phascolarctos cinereus (koala): 110193980
Entry
110193980         CDS       T05867                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110193980 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110193980 (ASIC1)
Ion channels [BR:pcw04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   110193980 (ASIC1)
SSDB
Motif
Pfam: ASC FAM176
Other DBs
NCBI-GeneID: 110193980
NCBI-ProteinID: XP_020821733
Position
Unknown
AA seq 629 aa
MFPPSSPSTILTKGSGTDSWTALGHGWLALPASPGLGILSPSLLAPLLPSFLPFSPRDII
SPSPSIDLPKMPIQIFCSLSFSSGEDPGAVRDSWGSNQQQQEGSESESEEEEEEEEEEER
EAKEEEEGLAMDLVAFANSCTLHGASHVFVSGGLGPRQALWAVAFALALGTFLYQVGDRV
TYYRSYPHVTLLDEVSTSELAFPAVTFCNTNAVRLSQLSYPDLLYLAPLLGLEDGEDPGV
PLAPPGPDAFSGEPFNLHRFYNRSCHRLEDMLLYCSYRGGPCGPHNFSVVFTRYGKCYTF
NAGQDGRPLLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQEEPPF
IDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYL
VENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQDYCVCEMPCNLTRYGKELSMV
KIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQM
GLFIGASILTVLELFDYAYEVIKHKLCRRGRCQKESKRNSADKGVALSLDDVKRHNPCES
LRGHPAGMTYAANILPHHPTRGTFEDFTC
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgttccctccttcttctccctctacaatcctcactaagggctcaggcacagacagctgg
actgctttggggcacggctggctggcattgcccgctagcccaggcctaggcatcttatcc
ccttctcttcttgctcctctccttccctccttccttcctttcagtcccagggacatcatc
tctccatctccctccattgatctcccaaagatgcccatccagattttctgctctctgtcc
ttttcctcgggcgaggacccgggggctgtaagagacagctggggctccaaccaacagcag
caggaggggtctgaatctgagtcagaagaagaggaagaggaggaggaagaggaagaaaga
gaggcaaaggaggaagaggaaggcttagctatggacttggtggcctttgccaacagctgt
actctccatggtgccagccatgtttttgtgtcaggaggcttagggccacgccaggcgtta
tgggctgtggcctttgccttggcactgggcacctttttgtaccaggtgggggatcgggta
acctattaccgaagctacccacatgtgaccctgctggatgaggtatccacttctgagctg
gcctttccagctgttaccttttgcaacacgaatgctgtgaggctgtcccagctcagctat
cctgacctgctctacctggccccactgcttgggctggaggatggggaagaccctggtgtg
ccccttgctccaccaggccctgatgccttctctggtgagcccttcaacttgcaccgtttc
tacaatcgctcctgccaccggctggaggacatgctgctctactgctcctatcgagggggc
ccctgtggcccccacaacttttctgtggtctttacacgctatggaaaatgctacacattc
aacgcaggccaggatgggcggccactgctgaagactatgaagggtgggacaggcaatggg
ctagagataatgctggacatccaacaggatgagtacctgccagtctggggagagacggat
gaaacttcctttgaggctgggatcaaggtgcagatccacagtcaagaggagccgcctttc
attgaccagctgggctttggtgtggctcctggattccagacctttgtggcttgccaggag
caacggctcatctacttgcctccaccctggggtacttgtaaagctgttaccatggactca
gatttcttcgactcatacagcatcacagcctgtcgaattgactgtgaaactcgttatcta
gtggagaactgcaactgccgcatggtgcacatgccaggtgatgctccatactgcacacct
gagcaatataaggagtgtgcagatcctgctctggatttcctggtggagaaggaccaggac
tactgtgtgtgtgaaatgccctgtaacctgactcgctatgggaaggagctgtccatggtc
aagattcccagcaaagcctcagccaagtatctggccaaaaagttcaacaagtcggagcag
tacattggggagaacatcctggtgctggacatcttttttgaagtcttgaactatgagacc
attgaacaaaaaaaagcctatgagattgcaggactcctgggtgacattgggggtcagatg
ggattgttcattggcgcaagcatcctgactgttctggaactcttcgactatgcttatgag
gtgattaagcacaagctgtgccgtcggggcaggtgccagaaggagtctaaaaggaatagt
gcagacaagggtgtagccctcagcctggacgatgtcaagcgacataacccctgtgagagc
ctccggggccatcctgctgggatgacatatgccgccaacatcctacctcaccatccgacc
cgaggcacctttgaggactttacctgctga

DBGET integrated database retrieval system