KEGG   Phascolarctos cinereus (koala): 110195322
Entry
110195322         CDS       T05867                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00100  Steroid biosynthesis
pcw01100  Metabolic pathways
Module
pcw_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110195322 (TM7SF2)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110195322 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 110195322
NCBI-ProteinID: XP_020823677
UniProt: A0A6P5INI8
Position
Unknown
AA seq 451 aa
MDGLDGRPGQARGRTQPGALCLSLRLGFRTMAHQQTSPRSDELEFGGPLGTAAMLLLLPV
VLFHLLLTCHSGPCSLLSLPSELPPASAFWSPWALLLLLLWLGLQATLYLLPMGKVSEGR
MLRDKSHLRYPINGFRCLGLTALLVGLGLAGGLPLGSLPELLLPLASAAAAIAFILSLLL
YLKSFTVPPSALAPGGNSGNIVYDFFLGRELNPRFGSFDLKYFCELRPGMIGWALINLAV
LLREAERHGGRPSLAMGLVNAFQLVYVVDALWNEEAILTTMDIIHDGFGFMLAFGDLAWV
PFTYSLQAQFLLNHPQSLELPVAGAICLLFAIGYFIFRGANTQKNTFRRNPSDPSVAGLE
TIPTATGRRLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVTHLLPYFYVVYFTILLVHRE
DRDERQCLQKYGLAWREYCTRVPYRIVPYIY
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggacgggctggacggccgacctggacaggccagagggcgcacgcagccaggggccctt
tgtctttctctcaggctcggattcagaaccatggctcatcagcagacttccccgcgctct
gacgaactcgaatttggggggccactggggacggctgccatgctgctgctactccctgtg
gtcctcttccacctgctcctcacctgccactcgggcccctgtagcctgctcagcctgccc
tctgagctgcccccagcctctgccttctggagtccttgggctctgctgctgcttctgctc
tggctggggctgcaggctacactgtacctgctgcccatgggcaaggtatctgagggcagg
atgctgagagacaagagccacctgcgatatccaattaatgggtttcggtgcctgggcctg
acggctctgctggtggggctggggctggcagggggtctgcccctcgggagcctcccagag
ctgctcctgccgttggcttcagcagccgcagctatagccttcatcctcagcctcctcctc
tacctcaagtcctttacagtgccgccttcagccctcgcccctggggggaattcaggtaac
atcgtctatgacttcttccttggccgagaactgaatccccgattcggatcctttgacctc
aagtatttttgtgagcttcgtccagggatgattggctgggccctgatcaacctggctgtg
ttgctgcgggaggctgagcgccatgggggtcggccttccttggccatggggctggtcaat
gccttccagcttgtctacgtcgtggacgctctttggaatgaggaggcaattctaactacc
atggacatcatccatgatggctttggcttcatgctggctttcggggacctggcctgggtc
cccttcacctacagtcttcaagcccagttccttctgaatcatccccagtctttggagttg
cctgtggctggggccatttgtctgctgtttgcgattggctactttatctttcgtggggcc
aacacacagaaaaataccttccggaggaacccttctgaccccagtgtggctggccttgag
accatccccacagctactgggcggcgcctgctggtatcagggtggtggggtatggtccgt
catcccaactaccttggagacctaatcatggctctggcctggtccctgccctgcggggtg
acacacctgcttccctacttctacgttgtctactttaccattttactggtgcatcgggag
gaccgagatgagcgccagtgtctccagaagtatggcctggcctggcgggaatactgcaca
agggtgccctaccgtatagtaccctacatctactga

DBGET integrated database retrieval system