KEGG   Phascolarctos cinereus (koala): 110196320Help
Entry
110196320         CDS       T05867                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00020  Citrate cycle (TCA cycle)
pcw00640  Propanoate metabolism
pcw01100  Metabolic pathways
pcw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110196320 (SUCLG1)
   00640 Propanoate metabolism
    110196320 (SUCLG1)
Enzymes [BR:pcw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110196320 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110196320 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 110196320
NCBI-ProteinID: XP_020825148
Position
Unknown
AA seq 350 aa AA seqDB search
MTGAARASAGAAFAAIMTSGCAGLAAAAGRLARSFLLQQSGVRHCAYVASRQNLYIDKNT
KVICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATAS
MIYVPPPFAAAAVQEAVEAEIPLIVCITEGIPQQDMVRVKHALLRQGKTRLVGPNCPGVI
NPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDF
IDCLEVFLKDPTTEGIILIGEIGGNAEENAAAFLKQHNTGPKAKPVVSFIAGLTAPPGRR
MGHAGAIIAGGKGGAKEKIAALQNAGVVVSMSPAQLGSTIYKEFEKRKML
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagccgcccgagcctctgctggagccgcttttgccgcaatcatgacttcgggc
tgtgcgggcctcgccgccgctgccggccgcctggcgcgctccttcctcctgcagcagagt
ggagtccggcattgcgcctatgtggcctcaaggcaaaacctctacatcgataagaacaca
aaggtcatttgccaaggtttcactggcaagcagggcacctttcacagccagcaggcattg
gagtatggcacgaaactggtcggaggaacgacgccaggaaaaggaggcaagacgcatttg
ggcttgccagtctttaatactgtgaaggaggccaaagaacagactggagccacggcttcc
atgatttacgtgcctcctccctttgctgccgctgcagtgcaagaggctgtggaggctgag
atacctctcatcgtgtgcatcacagaagggatcccacagcaggacatggtgcgcgttaaa
catgccctgctccggcaggggaagaccaggcttgttggccccaattgccctggagtcatc
aatcctggggaatgcaaaattggcatcatgcctggccacattcacaagaaaggcagaatt
ggcatcgtgtcgagatctggcactctcacctatgaagccgttcatcagacgacccaagta
ggcctgggccagtcgctgtgtattgggattggcggtgatccctttaatggaacagacttt
attgactgccttgaagtcttcctgaaagacccaaccacagaaggtatcatcctgattggc
gagattggtggcaatgccgaagagaacgcagcagccttcttgaaacaacacaatacaggt
ccaaaagccaaacctgtagtgtccttcattgctggcttgaccgcgcctccaggaaggaga
atgggtcatgctggggccatcattgctggggggaaagggggagcgaaggagaaaatcgct
gctctccagaatgcaggagtggttgtcagcatgtcccctgcccagctgggcagcaccata
tacaaagagtttgagaagaggaagatgttatga

DBGET integrated database retrieval system