KEGG   Phascolarctos cinereus (koala): 110199299Help
Entry
110199299         CDS       T05867                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03040  Spliceosome
pcw04010  MAPK signaling pathway
pcw04141  Protein processing in endoplasmic reticulum
pcw04144  Endocytosis
pcw04213  Longevity regulating pathway - multiple species
pcw04612  Antigen processing and presentation
pcw04915  Estrogen signaling pathway
pcw05134  Legionellosis
pcw05145  Toxoplasmosis
pcw05162  Measles
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110199299
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110199299
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110199299
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110199299
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110199299
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110199299
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110199299
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110199299
  09172 Infectious disease: viral
   05162 Measles
    110199299
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110199299
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110199299
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pcw03041]
    110199299
   03009 Ribosome biogenesis [BR:pcw03009]
    110199299
   03110 Chaperones and folding catalysts [BR:pcw03110]
    110199299
   04131 Membrane trafficking [BR:pcw04131]
    110199299
   03051 Proteasome [BR:pcw03051]
    110199299
   03029 Mitochondrial biogenesis [BR:pcw03029]
    110199299
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110199299
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110199299
Spliceosome [BR:pcw03041]
 Complex B
  Other components
   Prp19 complex
    110199299
 Complex C
   Prp19-CDC5 complex
    110199299
Ribosome biogenesis [BR:pcw03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110199299
Chaperones and folding catalysts [BR:pcw03110]
 Heat shock proteins
  HSP70 / DNAK
   110199299
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110199299
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110199299
Proteasome [BR:pcw03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110199299
Mitochondrial biogenesis [BR:pcw03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110199299
Exosome [BR:pcw04147]
 Exosomal proteins
  Proteins found in most exosomes
   110199299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 110199299
NCBI-ProteinID: XP_020829731
Position
Unknown
AA seq 643 aa AA seqDB search
MSSAKGTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPQNTVFDAKRLIGRKFGDSVVQSDMKHWPFQVINDGGKPKVQVSYKGENKAFYPEE
ISSMVLTKMKETAEAYLGYSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDRSGKGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT
RARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLSGIPPAPRGVPQIEVTF
DIDANGILNVTAVDKSTGKANKITITNDKGRLSKEEVERMVQEAEKYKAEDEAQREKVSA
KNALESYAFNMKSAVEDEGLKGKISEEDKRKVLEKCQEAISWLDANQLAEKEEFEHKRKE
LEQVCNPIITGLYQGAGGPPGGSSGAHSQHSSSGTGPTIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgccaaaggtaccgccattggcatcgacctgggcaccacctactcctgtgtg
ggggtgttccagcatggcaaggtagagatcattgctaatgaccagggcaaccgcaccact
cccagctatgtggccttcacagacacagagagactcattggggatgcagccaaaaaccag
gtggctttgaatccccagaacacagtctttgatgccaaacgtctgattggccgcaaattt
ggagattcagtggtgcaatccgacatgaagcactggcccttccaggtgataaatgatggg
ggcaaacctaaagttcaggtgtcctacaaaggtgagaacaaggccttctaccctgaagag
atctcctccatggtgctgaccaagatgaaggagactgctgaggcttatttgggctactca
gtcaccaatgctgtcatcactgtcccagcctattttaatgactctcaacgccaggccacc
aaggatgctggggtgattgctggcctcaatgtgctgagaatcatcaatgagcctacagca
gctgccattgcttatggcctggaccggtctggtaaaggtgagagacatgtcctgatcttt
gacttgggtgggggcacttttgatgtctccattctcaccattgatgatgggatttttgag
gtgaaagccactgctggagacacccacctgggtggggaggactttgacaaccgaatggtg
aaccattttgttgaggaattcaagcgaaaacataagaaagatatcagccagaacaagcgt
gctgtgagaagacttcgaacagcctgtgagagagctaagagaaccctgtcttccagcacc
caagccagcctggaaattgattccttgtttgagggtattgacttctatacctccattacc
cgagccaggtttgaagagctgtgctcagatctgttccggggcaccctggagcctgtagag
aaagccctgcgagatgccaagatggacaaggctcagatccatgacattgtccttgtgggt
ggctctactcgaatccccaaggtgcagaaactgctgcaagatttcttcaatggcagagac
ctgaacaagagtatcaaccctgatgaggctgtggcctatggagcagcagtgcaggcagcc
attctgatgggtgacaaatcagagaaagtgcaggacctgttgctgctggatgtggcacca
ctttccttggggctggagacagcaggaggtgtgatgacagcactgatcaaacgcaactcc
accatccccaccaagcagacccagatcttcaccacctattctgacaaccagccaggtgtc
ctgatccaggtatatgagggagaacgggccatgaccaaggacaacaacctcctgggtcgt
tttgacctgagtggcatccctcctgctccccgtggtgtcccccagattgaggtgaccttt
gacattgatgctaatggaattctgaatgtcacagctgtggataagagcacaggcaaagcc
aacaagatcaccatcactaatgataaagggcgcctgagcaaggaagaagtggaaagaatg
gtacaagaggcagagaagtataaagctgaagatgaggcccaaagggagaaagtttctgcc
aagaatgctctggaatcttatgctttcaacatgaaaagtgcagtggaggatgaaggcctg
aagggcaagattagtgaggaagacaagagaaaggtgctggagaaatgccaggaggctatt
tcttggcttgatgccaaccagctggctgagaaagaagagtttgagcataagaggaaggag
ttggagcaggtgtgtaaccctatcattacaggtctttaccagggtgctgggggtccccct
gggggaagttctggggctcattcccagcattcaagctctggaacaggccccactattgaa
gaagtggattaa

DBGET integrated database retrieval system