KEGG   Phascolarctos cinereus (koala): 110199940Help
Entry
110199940         CDS       T05867                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00010  Glycolysis / Gluconeogenesis
pcw00562  Inositol phosphate metabolism
pcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110199940 (MINPP1)
   00562 Inositol phosphate metabolism
    110199940 (MINPP1)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110199940 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110199940 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1 DUF4708 SpoVIF
Motif
Other DBs
NCBI-GeneID: 110199940
NCBI-ProteinID: XP_020830624
Position
Unknown
AA seq 475 aa AA seqDB search
MLPLRRRQRRLLLRWGLGVPGAAVLLACVAACALAERAPAGRASALSAYFGTKSRYEDVA
RPRPGPGLGPAGSCAPLQLVALVRHGTRYPTAKQVGRLRALHGLLLRAGPPGPGLAGALA
RWPLAYEDWMDGQLVDKGRRDMRQLAARLAARFPPLLGRAGLARVRLVSSSKPRCVDSAV
AFARGLWAQLHPGRPEPEPADVEFGPPEINDKLMRFFDHCEKFLAEVEKNDSALHQVEAF
KNGPEMQKIIKKVAAILQVPISDLNADLIQVAFFSCSFDLAIRDIQSPWCDVFDTEDAQV
LEYLNDLKQYWKRGHGYAINSRSSCSLFQDIFHHLDEAVEQRQRSQPISSPVIFHFGHAE
TLLPLLSLMGYFKDKEPLTAYNYKEQMNRQFRSGHIVPYAANLIFVLYHCEHAETPAREY
QVQLLLNEEPLPFVHSPGTVAVYQELKDHYKDVLQSCHSDQECVLPNINITSDEL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgctccccctgaggcggcggcagcggcggctgctgctgcgctgggggctcggggtcccg
ggcgccgccgtcctgctcgcctgcgtggcggcctgcgccctggcggagcgggcgcccgcg
ggccgcgcgtcggcgctgagcgcgtacttcggcaccaagagccgctacgaggatgtggcg
aggccgcggccggggccggggctgggccccgcggggtcgtgcgcgccgctgcagctcgtg
gccctggtgcgccacggcacccgctaccccacggccaagcaggtgggccgcctgcgggcg
ctgcacgggctgctgctccgcgccgggccgccggggccgggcctggcgggcgcgctggcg
cgctggccgctggcctacgaggactggatggacgggcagctggtggacaagggccggcgc
gacatgcgccagctggccgcccgcctggccgcgcgcttcccgccgctgctgggccgcgcc
ggcctggcccgcgtgcgcctcgtgtccagctccaagccgcgctgcgtggacagcgccgtg
gccttcgcacggggcctctgggcgcagctgcacccgggccgcccggagcccgagccggca
gatgtggagtttgggccacctgagataaatgataaacttatgaggttttttgatcattgt
gaaaagttcctagctgaggtggaaaagaatgattcagctcttcatcaggtagaagccttc
aaaaatggaccagaaatgcagaaaattattaaaaaagttgcagctattttgcaggtgcca
ataagtgatttaaatgcagatttaatccaagtcgcctttttttcctgctcatttgacttg
gctattagagacattcagtccccctggtgcgatgtctttgacacagaggatgctcaggtg
ctggaatacctgaatgacctgaagcagtattggaaaaggggacacggctatgcaatcaac
agtcggtccagctgcagcctgttccaggacatatttcatcatttggacgaagctgttgaa
cagagacaaaggtctcagcccatctcttctccagtcatcttccactttggacacgcagag
acgctgctgccactgctttctctcatgggctattttaaggacaaagaacccctcactgcc
tacaattacaaggagcaaatgaaccgtcagttccggagcggccacattgtaccctacgcg
gccaatctcatatttgtgctttaccattgtgagcatgccgagacgcctgccagggagtac
caggtgcagctgctgctgaacgaagagccactgccttttgttcactcgccaggaactgtc
gctgtgtatcaggagctgaaggaccactataaagacgtcttgcagagctgccactcggac
caagagtgtgtcttaccaaatatcaacatcacgtctgatgagctctga

DBGET integrated database retrieval system