KEGG   Phascolarctos cinereus (koala): 110200182Help
Entry
110200182         CDS       T05867                                 

Gene name
ST3GAL3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00514  Other types of O-glycan biosynthesis
pcw00515  Mannose type O-glycan biosynthesis
pcw00533  Glycosaminoglycan biosynthesis - keratan sulfate
pcw00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    110200182 (ST3GAL3)
   00514 Other types of O-glycan biosynthesis
    110200182 (ST3GAL3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    110200182 (ST3GAL3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    110200182 (ST3GAL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pcw01003]
    110200182 (ST3GAL3)
Enzymes [BR:pcw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     110200182 (ST3GAL3)
Glycosyltransferases [BR:pcw01003]
 Terminal extension
  Sialyltransferase
   110200182 (ST3GAL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 Ion_trans
Motif
Other DBs
NCBI-GeneID: 110200182
NCBI-ProteinID: XP_020831024
Position
Unknown
AA seq 421 aa AA seqDB search
MKMGLVVLVRNLLLTLCLCLVLGFMYYAAWKLHLLRWEDPNSGALTFDSVGRTLGSGRRE
RNNVAFDFLSPLPSGLAVDSGQSRTQKEMIDARATQGPAQSKYDRLGFLLKLDSKLPAEL
ATKYANLSDGACKPGYASALMTAIFPKFSRPAPMFLDDSFRKWARIRDFVPPFGIKGQDN
LIKAILSATKEYHLTPALDSLSCRRCIIIGNGGVLANKSLGARIDDYDIVVRLNSAPVKG
FEKDVGGKTTLRITYPEGAMQRPEEYEKDSLFVLAGFKWQDFKWLKYIVYKEKVSASDGF
WKSVATRVPKEPPEIRILNPYFIQEAAFSFIGLPFNHGLMGRGNIPTLGTVAVTMALHSC
DQVAVAGFGYDMSSPNAPLHYYESVRMAAIKESWTHNIQREKEFLRKLVKAHVITDLTSG
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggcctggtggtgctcgtccggaacctgctgctcaccctctgcctttgcctg
gtgctgggcttcatgtactacgccgcctggaagctgcacctcctccgatgggaagacccc
aattcaggggctcttacctttgactccgttggacggaccctaggctcaggaaggagagag
agaaacaatgtggcctttgactttctgtctccgctgccctcaggccttgctgtggactca
ggacaatccagaacccagaaagagatgatcgatgcccgggccacccagggcccagcccag
tctaagtatgatcgattgggttttctcctgaaattggactcaaaattgcctgcagagtta
gcgaccaagtatgccaacttgtcagatggggcttgcaagcctggctacgcatccgccctg
atgaccgccatcttccccaaattctccaggccagcccccatgttcttggatgactccttc
cgcaagtgggcccgcatccgagactttgtgccaccctttggaattaaaggacaagataat
ctgatcaaagccatcctgtcagccaccaaagagtaccacctgacacctgccctggacagc
ctcagctgccgccgctgcattatcataggaaatggaggtgtccttgccaacaagtctttg
ggagcccggatcgatgactatgacattgtggtcaggctgaactcagctccggtgaagggt
tttgagaaggatgtcgggggcaagaccaccctgcgcatcacttaccctgagggcgccatg
cagcggccggaggagtatgagaaggactcactctttgtcctggctggcttcaagtggcaa
gacttcaaatggctcaagtacattgtctacaaggagaaagtgagtgcttcagatggtttc
tggaagtcagtggccactcgggtgcccaaggagccacctgaaatacgcatcctcaacccc
tacttcatccaggaggctgccttcagtttcattggactccccttcaaccatggcctgatg
ggccgagggaacatcccaactctgggcaccgtggcagtcaccatggccctgcacagctgt
gaccaggtggcggtggctggctttggctatgacatgagctcacccaacgccccacttcat
tactatgaatctgttcgcatggccgccatcaaggagtcctggacacataacatccagcga
gagaaggagttccttcggaagctggtgaaagcccacgtcatcactgacctcaccagtggc
atctga

DBGET integrated database retrieval system