KEGG   Phascolarctos cinereus (koala): 110201606Help
Entry
110201606         CDS       T05867                                 

Gene name
PRODH2
Definition
(RefSeq) probable proline dehydrogenase 2 isoform X1
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00330  Arginine and proline metabolism
pcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110201606 (PRODH2)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     110201606 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 110201606
NCBI-ProteinID: XP_020833039
Position
Unknown
AA seq 461 aa AA seqDB search
MLRTSQVLLSRVTSSTQGSGAQRPILRFDGEAFRLKRTGELIRALLVLRLCAWPPLVSYG
LTLLSWSRRLLGSRLSGALLRASVYGQFVAGETTAEVQDSVQRLQRLGLRPLLAVPTEEE
PGTDWRGEAWYEGNLNAMLHCVDLSCGPPGSLPPQPVIMQLRVTALTSAQLCKELTLRLR
ETGTSKELSPERFASTMESGKDLQISSLSPELNQHLKASLSRFHRIAQYARSQGVRLLVD
AEYTSLNPALTLFVSSLAVRWNCREEADEDGAPWVWNTYQAYLKDTYEQLNQAAEAAEQK
GLGFGVKLVRGAYLDSERAVAQRNRTADPTQPNYEATSRSYNRCLELMLGHVSRRGSRCQ
LMVASHNEESVTQAVKRMSDLGIPLDGAVCFGQLLGMCDHVSLALGQAGYVIYKSIPYGS
LDEVIPYLLRRAQENRSVLQGARREQELLSQELLRRLSRRP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaaccagccaagtactactatctcgggttacctcctctacgcagggctcagga
gcccagaggccaattttgcggtttgatggggaagcattccgtctcaaaaggacaggcgaa
ctaatccgggccttgttagtgcttcggctctgtgcatggcccccactggtcagttatggt
ctaacgcttctgtcttggtcccggaggctcctgggctcccggctatctggggcactactt
cgggcttcagtgtatgggcagtttgtggctggggagacaacggctgaggtgcaagactct
gtccagaggcttcaaagacttgggctgcggccactgctggctgtacccactgaggaggag
ccagggacagactggagaggagaagcctggtatgagggaaacctgaatgctatgctgcat
tgtgtggacctgtcctgtgggcccccaggatctctaccaccccagccagtcatcatgcag
ctcagagtgacagcactgaccagtgcccaactctgtaaagaactgacgctccgactcagg
gagactgggacttccaaagagctaagtcctgaaaggtttgcttccaccatggaaagtggt
aaggacctacagatttccagtctcagtcctgagctgaatcagcatctcaaagcctcactg
agccgcttccatcgcattgctcagtatgcccggagccagggtgtccggctgctagtggac
gccgagtacaccagtctgaacccagcactgaccctgtttgtgtcttccctggctgtccgt
tggaactgccgggaggaggctgatgaggatggggctccctgggtatggaacacctaccag
gcctatctcaaggatacatatgagcagctgaatcaggcagcagaggcagcagagcaaaaa
ggtctgggttttggagtaaagctggttcgtggtgcatatctggattcagagagggcagtt
gctcagcgtaacaggacagcagatcctacccagcccaactacgaggccacgagccgaagt
tataaccgttgcctggagctgatgctgggacatgttagccgccggggttcacggtgtcag
cttatggtagcttcccacaatgaagagtctgtgacccaggccgttaagcggatgtcagat
ttgggcattcctctggatggtgctgtttgctttggacagttgctaggcatgtgtgaccat
gtctcccttgccttggggcaagctggttatgtcatctacaagtctatcccctatggttct
ctggatgaggtgattccctacctgcttcgtcgggcccaggagaaccgaagtgtgcttcaa
ggggccaggagagagcaggagctgctgagccaggagcttcttcggcgtttgtctcgccgt
ccttaa

DBGET integrated database retrieval system