KEGG   Phascolarctos cinereus (koala): 110202335Help
Entry
110202335         CDS       T05867                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04024  cAMP signaling pathway
pcw04080  Neuroactive ligand-receptor interaction
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04723  Retrograde endocannabinoid signaling
pcw04724  Glutamatergic synapse
pcw04728  Dopaminergic synapse
pcw04730  Long-term depression
pcw05014  Amyotrophic lateral sclerosis (ALS)
pcw05016  Huntington disease
pcw05017  Spinocerebellar ataxia
pcw05031  Amphetamine addiction
pcw05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    110202335 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110202335 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    110202335 (GRIA1)
   04728 Dopaminergic synapse
    110202335 (GRIA1)
   04720 Long-term potentiation
    110202335 (GRIA1)
   04730 Long-term depression
    110202335 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    110202335 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110202335 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    110202335 (GRIA1)
   05016 Huntington disease
    110202335 (GRIA1)
   05017 Spinocerebellar ataxia
    110202335 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    110202335 (GRIA1)
   05033 Nicotine addiction
    110202335 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110202335 (GRIA1)
Ion channels [BR:pcw04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   110202335 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF659
Motif
Other DBs
NCBI-GeneID: 110202335
NCBI-ProteinID: XP_020834023
Position
Unknown
AA seq 902 aa AA seqDB search
MQCIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERKTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYDWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLGKKKDRLVVVDCESERLNAILGQIIKMEKNGIGYHYILANLGFMDMDL
AKFKESGANVTGFQLVNYTDTIPAKILQQWKNNDVRDHTRVDWKKPKYTSALTYDGVRVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDPATSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDYGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTATLPRNSGAGGSGENGRVVSHDFPKSMQAIPCMSHSSGMPLGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattttcgccttcttttgcaccggttttctaggggcggtagtaggtgccaat
ttccccaacaacattcagatcgggggattatttccaaatcaacaatcccaggaacatgca
gcttttagattcgcattgtcgcaactcacagagcccccgaaactgctcccccagattgat
atagtgaacatcagcgacagctttgaaatgacgtatagattctgctcccaattctccaag
ggtgtctacgccatctttggattttacgagaggaagacggtcaacatgctcacctccttc
tgtggggccctccacgtctgcttcatcacgcccagcttccctgttgatacatccaatcag
tttgttctccagctgcgccctgagctgcaggatgccctcatcagcatcattgaccactat
gactggcagaaatttgtgtatatttatgatgccgatcgggggttgtcagtcctacagaaa
gtcctagacaccgctgccgagaagaactggcaagtgacagctgtcaacatcttaacaaca
acagaggagggctatcggatgctttttcaagacctagggaagaagaaggaccggctggtg
gtagtggactgtgaatcagagcgcctcaatgccatcctgggccagatcataaaaatggaa
aagaatggaattggctaccactacatcctggcaaacctgggtttcatggacatggatctg
gctaagttcaaggagagtggtgccaacgtgactggtttccagttggtaaattacaccgac
accatccccgccaagatattacaacagtggaaaaacaatgatgtccgtgatcatacccgt
gttgactggaagaagccgaaatatacctcggcactgacatatgatggtgttagggtgatg
gcggaggccttccagagcttgaggaagcagcgtattgatatctcccgcaggggaaatgct
ggggactgcttggccaatccagctgtgccctggggccaagggattgacatccagagggct
ctacagcaggtacggtttgaaggcttgaccggaaacgtacaatttaatgagaaaggacga
cgcaccaactacaccctccacgtgatagaaatgaagcacgatggcattcggaagattggt
tactggaatgaagatgacaagtttgtccctgcagccactgatgcccaggctggtggtgat
aactctagcgtccagaacagaacatatattgtcacaaccatcctagaagacccttatgtg
atgctaaaaaagaatgccaaccagtttgagggcaatgaccgctatgagggctactgtgtg
gagctagcagctgagattgccaaacacgtaggttactcttatcgtctggagatagtcagc
gatggaaaatatggtgcccgagaccctgacacaaaggcatggaatggcatggtgggggaa
ctggtctatgggagagcagatgtggctgtggcccccttgactatcaccttggttcgagag
gaagttattgacttttctaagcctttcatgagtttgggtatctccatcatgatcaagaaa
ccccagaagtccaagccaggggttttctccttcctggatcctctggcctatgaaatttgg
atgtgtatcgtgtttgcttacattggcgtgagtgttgtcctctttctggtcagtcgcttc
agcccctatgagtggcacagtgaagaatttgaggaaggacgtgacccagcaaccagtgac
cagtccaatgagtttgggatcttcaacagcctctggttctctctgggagctttcatgcag
caaggctgtgacatttcacccaggtctctctctggccgaattgttggtggcgtctggtgg
ttcttcaccttgatcatcatctcctcctacacggctaacctggcagctttcctgaccgta
gagaggatggtatctcctattgaaagtgctgaagacctggctaaacaaactgagattgct
tatgggaccctggaggcaggatcaactaaagaattctttaggaggtcaaagattgctgtc
tttgagaagatgtggacatatatgaagtcagctgagccctcagttttcgtgagaaccaca
gaggagggcatgatccgggtgaggaaatctaaaggcaagtacgcctacctcctagagtct
acaatgaatgaatacattgaacagcggaagccctgtgacacgatgaaggtgggaggtaac
ttggattctaaaggctatggcattgcgacacccaaggggtcagctctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggagtgtggcagcaaggactacggaagtaaggataaaacaagtgct
ctgagcctcagcaatgtggccggggtgttctacatcctgatcggaggcctcggactggcc
atgctggttgccttaatcgagttttgctacaagtctcgtagtgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacagcaaccctgcct
cggaatagtggagcaggaggcagtggagagaacggccgtgttgtcagccacgacttcccc
aaatccatgcaagcaattccatgcatgagccacagctcggggatgcccttgggagccaca
ggattgtaa

DBGET integrated database retrieval system