KEGG   Phascolarctos cinereus (koala): 110203169Help
Entry
110203169         CDS       T05867                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1B-like
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04060  Cytokine-cytokine receptor interaction
pcw04350  TGF-beta signaling pathway
pcw04360  Axon guidance
pcw04390  Hippo signaling pathway
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110203169
   04390 Hippo signaling pathway
    110203169
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110203169
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110203169
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    110203169
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110203169
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110203169
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pcw04090]
    110203169
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110203169
Protein kinases [BR:pcw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110203169
CD molecules [BR:pcw04090]
 Proteins
  110203169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Pkinase_fungal Haspin_kinase FTA2 APH DUF3611 Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 110203169
NCBI-ProteinID: XP_020835307
Position
Unknown
AA seq 448 aa AA seqDB search
MDIRRDYIPDMEDSQCKGMGIGNSITSAGCIMPPDPVCFASQLGLSSAQMEAKRKFKEQV
EFADESIQHKAILISVTVCSFLLILLILFWFFRYTRRKARHHHSIRLHQDEIYIPPEERL
KDFIEQSQNSGSRLGLSPLVQRTIARQVEMVQQIGKGRYGEVWMAKWRGEKVAVKLFSST
EEASWSREKEIYLTVLVRHENILGFIAGDIKGTGSLTQLCLITDYHENGSLYDYLQSTTL
DTKAMLKLAYSSVSGLCHLHTEILSTETKPAIAHRDLKSKNILVKENGACCIADLGLAVK
FVSVTSKIDVPANTRVGTKRYMAPEVLDETLDHNHFYSYIAADMYSFGLILWEIARRCVS
GGIVEEYQLPYYDLVPSDPSFEAMREIVCIQKLRPSVPDRWNSDECLRRMGRLMIECWAH
KPSCRLTALRVKKTLAKMSESQDTPNSN
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggatataagaagggactacattccagacatggaagacagtcaatgcaaaggcatgggc
attggaaatagcatcacatcggctggctgcataatgcccccagatccagtctgctttgct
tcacaacttggtctgtcttctgcacagatggaggcaaaaagaaaattcaaggaacaagtt
gaatttgctgatgaatccatacagcataaggccatactgatatctgtgacagtctgtagc
ttccttctgatccttctgattctgttctggtttttcaggtatacgagacgaaaagcaaga
catcatcacagcatcagactgcaccaggatgagatttacattcctccagaggaacgcttg
aaagatttcattgaacagtctcagaactcaggaagtagattagggctttctccactggtc
caaaggactatagctaggcaggttgagatggtccaacagattggaaaaggtcgctatggg
gaagtttggatggcaaagtggcgtggtgaaaaggtagctgtgaaactgttctcctccact
gaggaagccagctggtccagagagaaagaaatatatctgacggtcttggtgaggcatgaa
aatattttgggatttattgctggagacatcaaaggcacagggtccttgacccaactctgc
ctaatcacagactaccatgagaatgggtccttatatgattatctgcagtctactacccta
gataccaaagcaatgttaaagttggcctactcttcagtcagtggcctgtgccacttacat
acagagatcttaagcactgaaacaaaaccggcaattgcacatcgtgatctgaaaagtaag
aacatcctggtgaaggaaaatggagcatgctgtatcgctgatctgggattggccgttaag
tttgtcagcgtcaccagtaaaatagatgtcccggccaacactcgagtgggcaccaagcgt
tacatggcgcccgaggtgctggatgagactttggatcacaaccacttctattcctacatc
gcagcagatatgtacagttttggcctcattctgtgggaaattgcccggagatgtgtgtca
ggtggaatagtggaagaataccagcttccctactatgacctggtacccagtgatccctcc
tttgaagctatgagggagatcgtgtgcatccaaaaactccgtccctccgttcccgacagg
tggaatagtgatgagtgtctacggcggatggggaggctcatgatagaatgctgggcccac
aaaccttcttgccgtctcacagcccttcgggttaaaaaaacccttgccaaaatgtcagag
tcgcaggacacaccaaactctaattga

DBGET integrated database retrieval system