KEGG   Phascolarctos cinereus (koala): 110205002Help
Entry
110205002         CDS       T05867                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00350  Tyrosine metabolism
pcw00360  Phenylalanine metabolism
pcw00380  Tryptophan metabolism
pcw01100  Metabolic pathways
pcw04726  Serotonergic synapse
pcw04728  Dopaminergic synapse
pcw05030  Cocaine addiction
pcw05031  Amphetamine addiction
pcw05034  Alcoholism
Module
pcw_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
pcw_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110205002 (DDC)
   00360 Phenylalanine metabolism
    110205002 (DDC)
   00380 Tryptophan metabolism
    110205002 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110205002 (DDC)
   04726 Serotonergic synapse
    110205002 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    110205002 (DDC)
   05031 Amphetamine addiction
    110205002 (DDC)
   05034 Alcoholism
    110205002 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110205002 (DDC)
Enzymes [BR:pcw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110205002 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     110205002 (DDC)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110205002 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110205002
NCBI-ProteinID: XP_020836967
Position
Unknown
AA seq 485 aa AA seqDB search
MNAAEFRKRGKEMVDYVADYMEGVHKRQVYPGVEPGYLRPLIPDSAPQEPETFEDIIKDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADILSGAIGCIGFSWIASPACTELETVMLD
WLGKMINLPEAFLAGKDGEGGGVIQGSASEATLVTLLAARTKVIRELQAKCPGLTKAAIM
DKLVAYASDQSHSSVERAGLIGGVKLKMLPTDDKFSLRGSALQKVLDEDKAAGLIPFFMV
ATLGTTSCCSFDNLLELGPICNKENIWMHIDAAYAGSSFICPEFRHLLNGVEFADSYNFN
PHKWLLVNFDCSTMWVKKRADLIGAFKLDPLYLQHQNQDSGLVTDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVKLSHEFESLVHKDPRFEICAEVVLGLVCFRMKGSNELN
EALLEKINKSKKIHLVPCHLRDKFVLRFAICSRTVESVHIQHAWQHITELATELLKKENE
QKMNQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgaattccgaaagagagggaaagaaatggtggattatgtggcagactat
atggagggagttcataaacgtcaggtctatccaggtgtggagccaggctatctgagaccc
ctgattcctgactctgctccccaggaaccagaaacatttgaagatatcattaaggatgtt
gagaagataatcatgccaggggtaactcattggcacagtccctacttctttgcttatttc
cccacagccagctcatatccagcaatgctggccgacatactatcaggtgcgataggctgc
attggcttttcctggattgcaagtcccgcttgcacagagctggagacggtgatgttggat
tggctggggaagatgattaatctgccagaagcgtttctagctggaaaagatggagaaggt
ggaggagtgattcagggaagtgccagtgaagctactttggttaccctacttgccgctaga
accaaagtgattcgggagctacaggccaagtgtccaggactgacaaaggcagccatcatg
gacaagctggtggcctatgcatctgatcaatcgcactcatcagtggaaagggctggatta
attggcggcgtgaagttaaaaatgctccctacagatgacaaattttctctacgaggttca
gccctacagaaggtgctggatgaagacaaagctgctggcctcatcccattctttatggtt
gctacacttgggaccacttcttgctgttcatttgacaatctgttagagctgggtcctatt
tgtaataaggagaatatttggatgcatattgatgcagcatatgcaggaagttccttcatc
tgccctgaatttcggcatcttctgaatggggttgagttcgcagattcatataacttcaat
cctcacaaatggcttttggtgaattttgactgctctaccatgtgggtgaaaaagagagca
gacttgataggtgcctttaaactggatcctctttacctacagcaccaaaaccaagactct
ggtcttgtcactgactatcggcactggcagataccactaggccggagatttcgctctctg
aaaatgtggtttgtgtttaggatgtatggcgtgaagggactacaagcatatatccgcaag
catgtgaaattatcacatgaatttgaatctttggtgcacaaggacccccgatttgagatc
tgtgctgaagtcgtattggggctggtatgtttccgaatgaagggttccaatgaactgaat
gaagcacttcttgaaaaaattaacaaatccaaaaaaatccacttggtcccatgtcacctc
agagacaagtttgtgctgcgtttcgctatctgctctcgcacagtagagtctgtccacatc
cagcatgcctggcagcacattacagagctggcgactgagctgctgaaaaaggaaaacgag
cagaaaatgaatcagtaa

DBGET integrated database retrieval system