KEGG   Phascolarctos cinereus (koala): 110205804Help
Entry
110205804         CDS       T05867                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04020  Calcium signaling pathway
pcw04713  Circadian entrainment
pcw04925  Aldosterone synthesis and secretion
pcw04927  Cortisol synthesis and secretion
pcw04929  GnRH secretion
pcw04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110205804 (CACNA1I)
   04020 Calcium signaling pathway
    110205804 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    110205804 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    110205804 (CACNA1I)
   04927 Cortisol synthesis and secretion
    110205804 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110205804 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110205804 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110205804 (CACNA1I)
Ion channels [BR:pcw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110205804 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 110205804
NCBI-ProteinID: XP_020838314
Position
Unknown
AA seq 2115 aa AA seqDB search
MAECVLPAAAWNPSPLPPVSSAPDLASESGVTEQQPQPQTPPSSPAQEPGPSTDPDIPHP
DLAPVVFFCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCEDMDCLSDRC
KILQVFDDFIFIFFAMEMVLKMVALGIFGRKCYLGDTWNRLDFFIVMAGMVEYSLDLQNI
NLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWA
GLLRNRCFLEENFTVQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRE
CCLSKDDFAYYSAAHQDFNASGMCVNWNRYYNVCRTGSVNPHKGAINFDNIGYAWIVIFQ
VITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHQLM
QEQRRRYLSSSTVASYTEPGDCYEEIFQYVCHILRKAKRRSLGLYHALRSRHQGQVELSV
GAKPEAGNAKEQRPDRLCQKHIPLDYPPHTLVQPISVTQTSDPGNCPHCQRERDQHLSMA
ESDDDFGQEEGSVNDEEGEGGGSSEGTLDLEKEEEEGEKGSGAARLCGDVWREVRAKLRG
IVDSKYFNRGIMIAILVNTVSMGIEHHEQPEELTNILEISNVVFTSMFALEMILKLAAFG
LFDYLRNPYNIFDSIIVIISIWEIIGQSDGGLSVLRTFRLLRVLKLVRFMPALRRQLVVL
MKTMDNVATFCMLLTLFIFIFSILGMHIFGCKFSLRTDSGDTVPDRKNFDSLLWAIVTVF
QILTQEDWNMVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSY
SDEDQSSSNLEVFDKFREGQEGHFDVKLCPIPMTPNGHLDPSLSMPGALATMGGMPPGPC
HSLQPDQVLIALDSRKSSVMSLGRMSYDQRSLSSSRSSYYGAWGHSGAWASRRSSWNSLA
RGHSLKHRAPSAEHESLLSGERGRSAEAERDEGALRGPPHHLPPHPHHHHHHFHHHHHYR
HRRTLSLDTKDSLDLAEPPLPLAPHSHLRPARKVGTGPGASEHQDCNGKMPNIAKDVFTK
MDNRKDHAEDEEEIDYSLCFRIRKMIDVYKPDWCEIREDWSVYLFSPENRFRVLCQTIIT
HKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGL
YFGEQAYLRSSWNILDGFLVFVSLIDIVVSVASAGGATILGVLRVLRLLRTLRPLRVISR
APGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDIRNITNRSD
CMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWML
LYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRSKARPK
CALEAQRLPYYATYCPTRLLIHSVCTSHYLDIFITFIICLNVVTMSLEHYNQPMSLEIAL
KYCNYMFTTVFVLEAMLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPI
NPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVE
LFGKLVCSDEHPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCL
SNLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLC
PRSSGSPGSSKGGGCAAGAGPPAEPEARRCVRCYSPAQENLWLDSVSLIIKDSFEGELMM
IDNLSGSVFHHYSSPAVCERCDHDQQEVQLAEMEAFSLNSDKSSSILLGDDVSLEDPPAC
PVASKEVKQGESETPDPIKIGDLGECFFPLSNTAVSEAPESYLCEMEKDPFNPVQSWLKH
ESSQVPASPFSPDAASPLLPMPAEFFHPAVASSQKAEEKATCKGTLPKISLQGSWASLRS
PSVNCALLRQTTESDTSLDNSRSSGSVGSLQTTLDDSLNLSDSPQCTLDLPSALCPGLPG
PQRQGPQNCGGCCPLSSLPAQEPARPRPLQPANPARPPAQPQQRGQHQPWLHPPRLYGPL
RRGGGGQQPPGWRHQ
NT seq 6348 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtgtgttctgcctgctgctgcctggaatcctagccccctgccccctgtgtct
tcagccccggatcttgcctcggagtctggagtcacggagcagcagccccagccacagaca
ccgccctcctcaccagcccaggagccgggccccagcactgaccctgacatcccacaccca
gacctggcccccgtggtctttttttgtcttcggcaaaccaccagcccgcgaaactggtgc
atcaagatggtgtgtaatccgtggttcgagtgtgtcagcatgctggtgatccttctcaac
tgcgttaccctgggcatgtaccagccatgtgaggacatggactgtctgtctgatcgctgc
aagatcctgcaggtattcgacgacttcatcttcatcttctttgccatggagatggtgctg
aagatggtggccctggggattttcggcaggaagtgttacttgggggacacctggaatcgg
ctggatttcttcattgtgatggctgggatggtagaatattctctggaccttcagaacatc
aacctgtcggccatccgcacggtccgagtcctgaggcccctcaaagccatcaatcgagtg
cccagcatgcgcatccttgtgaacctgctgctggacaccctgcccatgctgggcaacgtg
ctgctgttgtgtttctttgtcttcttcatctttggcatcatcggcgtgcagctgtgggcc
ggcctgcttcggaaccgctgcttcctggaggagaatttcaccgtacaaggagatgttgcc
ctccccccctactaccagccggaggaggacgacgagatgcccttcatctgctcgctgtcg
ggggacaacggcatcatgggctgccacgagatcccccccctcaaagagcagggccgcgag
tgctgcctgagcaaagacgacttcgcctactacagcgcggctcaccaggacttcaacgcc
agcggcatgtgcgtcaactggaaccgctactacaacgtgtgccgcacgggcagcgtcaac
ccgcacaagggcgccatcaacttcgacaacatcggctacgcctggatcgtcatcttccag
gtgatcaccctggaaggctgggtcgaaatcatgtactacgtcatggatgcccactccttc
tacaacttcatctacttcatcctgctaattatagtgggctccttcttcatgatcaacctg
tgcctcgttgtcatagcgacccagttctccgagaccaagcagagagagcaccagctgatg
caggagcagcgcaggcggtacctgtcctccagcaccgtggccagctacacagagcctggg
gattgctacgaggagatattccagtatgtctgccacattctgcgaaaggccaagcgccga
agcctgggcctctaccatgccctccgcagccgccaccagggccaggtggagctcagcgtg
ggggccaagcctgaggcggggaatgccaaggagcagaggccggacaggctgtgccagaaa
cacattcccctggattacccaccccatacccttgtgcagcctatctctgtgacgcagacc
tccgaccctggcaactgcccccactgccagcgagagagagatcaacatctgtccatggca
gagagtgatgatgactttgggcaggaggaaggctctgtcaatgatgaagaaggggaaggt
ggagggagcagtgaaggaaccctggacctggagaaggaggaagaggagggagagaaaggc
agtggtgcagccaggctgtgtggggatgtgtggcgggaggtgagggccaagctgaggggc
atcgtggacagcaagtactttaaccgaggcatcatgatcgccatcctggtgaacacggtc
agcatgggcatcgaacaccatgaacagccggaggagctgaccaacatcttggagatcagt
aatgtggtgttcaccagcatgtttgccctggaaatgatcctgaagctggcggcctttggc
ctctttgactacctgcggaacccttacaacatctttgacagtattatcgtcatcatcagt
atctgggagatcattggccagtcggatgggggcctctcagtgctgcggacgttccgcctg
ctgcgggtgttgaagctggtccgcttcatgccagccctgcgccgccagctggtggttttg
atgaagaccatggacaacgtggccaccttctgcatgctgctcacgctcttcatcttcatc
ttcagcatcctagggatgcacatttttggctgcaaattcagcctcaggactgacagcgga
gatacggtgcccgaccggaagaactttgattcgctcctctgggccattgtcacagtgttc
cagatcctgacgcaggaggactggaacatggtgctctacaatggcatggcctccacctcg
ccctgggcctccctctactttgtggctctcatgacctttggcaactacgtgctcttcaac
ctgctggtggccatcctggtggagggcttccaggcagagggagatgccaaccgctcctac
tcagatgaggaccagagctcatccaacttagaggtgtttgacaagttccgggagggtcaa
gaaggccattttgatgtcaagctctgccccatccccatgacccccaatgggcacctggac
cccagcctttcgatgcctggtgccctggccactatggggggcatgcccccgggcccttgc
cactccctgcagcctgaccaggtgctgatcgccctggactcccgaaaaagcagcgtcatg
tctctggggaggatgagctatgaccagagatctctgtctagctcccgcagctcctactat
ggggcctggggccacagtggagcctgggccagccgcaggtccagctggaacagcctggcc
cggggccacagcctgaagcaccgggccccctctgcagagcatgagtcgctcctctctggg
gagaggggccggtcggcagaggcagagcgggatgagggcgccctgcgtggcccaccccat
cacctaccgcctcatccccatcaccatcaccaccacttccaccaccaccaccactaccgg
caccgtcggacgctctcccttgacaccaaggactccttggacctggcagagccaccgctg
ccactggcccctcactctcatctgaggcccgcccggaaggtgggcacgggcccgggcgcc
agcgagcaccaggactgcaacggcaagatgcccaacatcgccaaagatgttttcaccaag
atggacaaccggaaggaccacgcggaggatgaagaagagattgactatagcctgtgtttc
cgaatccggaagatgatagatgtttacaagcctgactggtgtgagatcagggaagactgg
tctgtctacctcttctctcctgagaacaggttccgggtcctctgtcaaaccattatcacc
cacaagctctttgactatgttgtcctggcttttatcttcctcaactgtatcaccatcgcc
ttggagaggccccagatagaggccggcagcacagagcgaatattcctcactgtgtccaac
tacatcttcaccgccatctttgttggagagatgacgctaaaggtggtctccctgggcctg
tattttggggagcaggcctacctccggagcagctggaacatcttggatggcttcctggtc
ttcgtgtccctcatcgacatcgtggtctctgtggcctctgcaggaggagccacgatcctc
ggggtcctccgggtcctccgcctcctccggacccttcgcccactcagggtcatcagccgt
gccccagggctgaagctcgtggtggagacgctgatttcatccctcaaacccattggaaac
attgtcctcatctgctgtgccttcttcatcatcttcggcatcctgggagtacagctcttc
aaggggaagttttaccattgcctcggggttgacattcggaacatcaccaaccgctctgac
tgcatggcagccaactaccgctgggtgcaccacaagtacaactttgacaacctgggccag
gccttgatgtccctcttcgtcttggcctccaaagatggctgggtcaacatcatgtacaat
gggctggatgctgtggccgttgaccagcagcctgtgaccaaccacaatccctggatgttg
ctgtatttcatctccttcctgctcatcgtcagcttcttcgtcctgaacatgtttgtgggg
gtggtggtggagaacttccacaagtgccggcagcaccaggaggcagaggaggcacgtcgg
cgggaggagaagcggctccggcggctggagaagaagcgaaggagtaaggcccggcctaag
tgtgcgttggaagcccagcggctcccatattatgctacctactgccctacccggctcctt
attcactctgtctgtaccagtcactacctggatatcttcatcaccttcatcatctgcctc
aatgtcgtgaccatgtctctggaacactacaaccagcccatgtccttggagatcgctctc
aaatactgcaactacatgttcactacggtctttgtgctggaagccatgttgaagctggta
gcttttgggctgcgacgcttcttcaaagacaggtggaaccagctggatctggccatcgtc
ctcctctcagtcatgggcatcacgctggaggagattgagatcaacgctgccctgcccatc
aatcctaccatcatccgcatcatgagagtgctgcgcatcgcccgagtgctgaagctgctg
aagatggccactgggatgcgagccctgctggacacagtggtgcaggccctcccccaggtg
ggaaacctgggccttctcttcatgctcctcttcttcatctatgctgctctgggcgtggag
ctctttgggaagctggtgtgcagtgatgagcacccttgtgagggcatgagccgccatgcc
accttcgagaacttcggcatggccttcctcacgcttttccaggtctcgactggggacaac
tggaacgggatcatgaaggacacgctgagggactgcacccacgacgagcgcagctgcctc
agcaacctccagttcatctcgccgctgtacttcgtcagcttcgtgctcaccgcccagttc
gtcctcatcaacgtggtggtggccgtgctgatgaagcatctggatgacagcaacaaggag
gctcaggaggacgcggagatggacgccgagatcgagctggagatggcccacggcctgtgc
cctcggagctcgggctccccgggctccagcaaaggcggcggctgtgcggccggcgcgggg
ccgcccgccgagcccgaggcgcgccgctgcgtgcgctgttactccccagcacaggagaac
ttgtggctggacagtgtctctttaattattaaggactccttcgaaggagagctaatgatg
attgataacctgtccggctccgtcttccaccattattcctccccggccgtgtgcgagagg
tgtgatcatgaccagcaagaggtccagctggctgagatggaggccttctccctgaactca
gacaagtcctcgtcaatcctgctgggggatgacgtgagcctggaggatcccccagcatgc
cctgtggcctccaaggaggtcaagcagggagagtcagagactcctgaccctatcaagatc
ggggacttgggagaatgcttcttcccgctgtccaacacagctgtctcagaggccccagag
agctacctgtgtgagatggagaaggaccccttcaatcctgtccagtcctggctgaaacat
gaaagcagtcaggttcctgccagtcctttctcacccgatgctgccagccctctcttgccc
atgcccgcagagttcttccatccagctgtggccagcagccagaaggccgaggagaaggcc
acctgcaaggggaccctgcccaagatctccctgcagggctcctgggcatccttacgatct
ccaagcgtcaactgtgccctcctccgacagaccacagagagcgacacctccctggacaac
agccggagcagcggctcggtgggaagcctccagaccacgctggacgacagcctgaatctc
agcgactctccccagtgcaccctggacctcccctccgccctgtgccccgggctgcccggc
ccccaacgccagggcccacagaactgtggtggctgctgccctctctccagcctcccggcg
caggagcctgcgaggccgcggcctcttcagcctgcgaaccctgcgaggccaccagcgcag
ccacagcagcgggggcagcaccagccctggctgcacccaccacgactctatggacccctc
cgacgaggagggggtgggcagcagcctccagggtggaggcaccaatag

DBGET integrated database retrieval system