KEGG   Phascolarctos cinereus (koala): 110205983Help
Entry
110205983         CDS       T05867                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00250  Alanine, aspartate and glutamate metabolism
pcw00270  Cysteine and methionine metabolism
pcw00280  Valine, leucine and isoleucine degradation
pcw00350  Tyrosine metabolism
pcw00360  Phenylalanine metabolism
pcw00380  Tryptophan metabolism
pcw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcw01100  Metabolic pathways
Module
pcw_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110205983
   00270 Cysteine and methionine metabolism
    110205983
   00280 Valine, leucine and isoleucine degradation
    110205983
   00350 Tyrosine metabolism
    110205983
   00360 Phenylalanine metabolism
    110205983
   00380 Tryptophan metabolism
    110205983
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110205983
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     110205983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox HI0933_like Pyr_redox_2 DAO AlaDh_PNT_C FAD_oxidored Thi4 FAD_binding_3 Pyr_redox_3 GIDA NAD_binding_7 Trp_halogenase Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 110205983
NCBI-ProteinID: XP_020838648
Position
Unknown
AA seq 556 aa AA seqDB search
MEMWGVLTLAFLLATPSCHGYSDLLAKCFQDPEYEAILKTAQEGLGTSAFKGHVLVVGAG
MSGLIAAKTLQDAGHKVTVLEARHKIGGRVVTFRSPEKNWYIELGAMRLPANHRLVRFYV
EKLGLKLNPFVQSSNNTWFYVNGRRHRTSDVLNNPNILGYRVRPEEAGKMPSELFKEAIA
KVVEKLKLTNCSHLLSIYDSFSTKAYLLKEGKLSREAVRMIGXILNEDAGYYKSLLESLR
SDIIFSNSSGFDEITGGFDQLPEALYHTLKPNTVLLGATVRKVETAGPQIKITYQSGSLD
SGQSVITGDFAIISSSAKATRLIQFQPPLSQAKQDALRSIHYSSATKVVLACKERFWEQD
GIKGGASITDLPTRFIYYPSHNYMSNVGVLLASYTVGDDSTFFLGLKHDKVVDMVLGDLA
IIHQRPKEELQRLCQTSVVKHWSLDPFSLGAFAEFTPYQFVDYSERLFQPEGNIYFAGEH
TCQPHAWIDTAIKSGLRAARNLQAAIDAAATVYDTNRDTDDYDTDYHAHVALNEGPSFFQ
GVKGKFQKACSSQSEL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggagatgtggggtgtgctgaccttggccttccttctggccactcctagttgccatggc
tactctgacctccttgccaagtgcttccaggaccctgagtatgaagctattctgaaaact
gcccaggaggggcttgggacctctgcctttaaggggcacgtcctggtggtgggagctggg
atgtcaggattgatagcagccaagacccttcaggatgctggacacaaggtgacagtgttg
gaagccaggcacaaaattgggggaagagtggtaacgttccggagcccagagaagaactgg
tacattgaactaggtgctatgaggttgccagccaaccacagactggtccgattctacgtg
gagaagctgggtctgaaactgaacccatttgtccagtctagtaacaacacctggttttat
gtcaatggccgccggcataggacctcagatgtgttgaacaatcccaacatcctgggctac
cgtgtgagacctgaggaggcaggcaagatgcccagtgaactcttcaaagaggcgatagct
aaggtggtagaaaaactgaagcttaccaactgcagccacctgttatctatatatgattcc
ttctccaccaaggcctacctgctaaaggaagggaagctgagccgggaagctgtccggatg
attgggnctatcttaaatgaagatgcaggctactacaagtctctcttggagtccctaagg
agtgacatcatcttctccaattcatctggctttgatgaaatcactggtggctttgatcag
ctccccgaggccctgtaccacaccttgaagcctaacactgtcttattgggggccacagtg
aggaaggtagagacagctgggcctcagatcaagattacctaccagagtggaagcctcgac
tcaggccagtctgtcatcacaggtgacttcgccataatctcatcatctgccaaggccaca
cgcctcatccagtttcagccgccactctcccaggccaagcaagatgccctccgctccatt
cactattccagtgccaccaaagtggtcctggcctgcaaggaacgcttctgggaacaggat
ggcatcaaaggtggggcatccatcacagacctgcccacgagatttatctactaccccagc
cataattacatgagcaatgtaggtgtccttttggcctcctataccgtgggtgatgactcc
acttttttcctgggccttaaacatgacaaggtggtggacatggtgctgggtgacttggca
atcatccaccagaggcccaaggaggagctacagagactatgtcagacatccgtggtgaaa
cattggtccctggatccgttctccctaggtgcattcgcagagttcaccccttaccagttt
gttgactattcagaaagactcttccagcccgagggcaacatctactttgctggtgagcac
acttgccagcctcatgcctggatagatacagcaatcaaatctgggctccgggcagcccga
aacctacaggcagccattgatgctgctgccactgtctatgataccaaccgtgatactgac
gactatgatactgactaccatgcacatgtggctttgaatgagggaccatctttctttcag
ggggtcaaaggaaagttccaaaaggcctgttcttcacagagtgaactttga

DBGET integrated database retrieval system