KEGG   Phascolarctos cinereus (koala): 110207597Help
Entry
110207597         CDS       T05867                                 

Gene name
ERLIN2
Definition
(RefSeq) erlin-2 isoform X1
  KO
K23341  erlin
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pcw04121]
    110207597 (ERLIN2)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    110207597 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 110207597
NCBI-ProteinID: XP_020840944
Position
Unknown
AA seq 367 aa AA seqDB search
MSKPSWMFIARLCRLLSPSFLSQQGKSFPMAQVGAVVAVATSFFCAALFSAVHKIEEGHI
GVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEV
VNFLIPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLA
LQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQKVVEKEAETER
KKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFLAREKAKADAECYTALKIAEA
NKLKLTPEYLQLMKYKAIASNSKIYFGKDIPNMFMDTAGSLAKQFEGQAEDLGSDLEDSW
GAATEEQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcccagctggatgttcatagccagactctgtagacttttgagcccttctttc
ctgtctcaacagggtaaaagcttcccaatggcgcaagtaggggcagtggtggccgtggcg
actagtttcttctgtgcagccctcttctcagccgtgcacaagattgaagaagggcacatt
ggggtgtactacagaggtggtgctctgttgacctccaccagtggccctggtttccatctc
atgcttcctttcatcacgtcgtataagtctgtgcagaccacactccagacagatgaagtg
aagaatgtgccttgtggaacaagtggtggtgtgatgatttacttcgacagaattgaggtg
gtgaacttcctgataccaaatgctgtatatgacatagtgaagaattacaccgctgactat
gacaaggccctcatcttcaacaagatccatcatgagctgaaccagttctgcagtgtacac
accctccaagaggtctatattgaactcttcgatcagattgatgaaaatctcaaactagct
ttgcaacaagacctgacctccatggcccctggacttgtcattcaggctgtgcgggtcaca
aagcccaacattcctgaggcaatccggagaaactacgaactaatggaaagtgagaagaca
aaactccttattgcagcacagaaacagaaggtggtggaaaaggaagcagaaacagagcgg
aagaaggctctcattgaggcagaaaaagtggctcaggttgcagaaatcacatatgggcaa
aaagttatggagaaggaaacagagaagaagatttcagaaatcgaagatgctgcattccta
gctcgagagaaggcaaaagctgatgccgagtgctatacagccctaaaaatagctgaagca
aataagctgaagctgaccccggaatacctacagctgatgaaatacaaggcaattgcctcc
aacagcaagatttactttggcaaagacatccccaacatgttcatggacaccgcaggcagt
ctggccaagcagtttgaggggcaggctgaggatctgggctctgaccttgaggacagctgg
ggtgcagccacagaggagcagtga

DBGET integrated database retrieval system