KEGG   Phascolarctos cinereus (koala): 110207920
Entry
110207920         CDS       T05867                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110207920 (AHRR)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110207920 (AHRR)
SSDB
Motif
Pfam: PAS PAS_3 HLH PAS_11 PAS_9
Other DBs
NCBI-GeneID: 110207920
NCBI-ProteinID: XP_020841330
Position
Unknown
AA seq 736 aa
MIPPGECMYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEQHFRTQGDHPVKEDHLPTGIAMPEGGLLLESLNGF
ALVVSAEGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMVF
GQPLQSETGEEYILDKLLKAQECDSMSTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKTPSGTLLPPQLSLFCVVVPILLPSVTEMKMKNVLLRAKQKADVAASTDAK
AKTTAGLCESELQGRAHFQGVKNNGENGVSVFKVQANDDHWVWVQANAQLLYRSGCSDYL
LNPQTVAKEEEEHLKMSGSTTSGKGRREPLMYNCSIETLGPMKHLNWTAEKHDQDGIKLK
FEPNKTDKCFLQEEGLSSCMPYPGVQNTCNTNSISPFRSSSNSQAMNSPLSAYPNRIIRP
FYNGDQSHLNPPSSCHPHQGGMENCQSCPGFQHLAVGSYASENVKLQSALIPPETLYNQM
LPLDIPIKMENDSDSDNGIDGYPISQNQVWLGESNVVKRHLISFPNRVHFKTEPEFTEHL
SPCENPKHYTYPPHHGQCVVSTHPNNRAISRSGKEISPFYSPNCAYLERMHGLQDTEYYN
HLYSPSSTNMKGHTEHQPYKLQCDFKAPGMVQMIKREPLDSPPWAGHSQSGVQVIFPKNA
LSTLMPHKATECTFLQ
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgattccaccgggagagtgtatgtatgctgggaggaaaagaagaaaacctattcagaaa
caaaggccggctgtggggaatgagaagtccaatccttccaagaggcaccgagaccggttg
aatgctgagctcgatcacctcgccagtctgttgccttttccacccgacatcatttcaaaa
ctggacaagctttccgtcttacgtctcagcgtcagctatctcagggtgaaaagcttcttt
caagctattcaggagcaacacttcaggacacaaggtgaccacccagtgaaagaagatcac
ctccccactggaattgccatgccggaagggggactgttgctagaatctcttaatggattt
gctctggtggtgagtgcagaaggaatgatattttacgcatcatcgacaattgtggactac
ctgggctttcatcagactgatgtaatgcaccaaaacatatatgattatattcatgtggac
gaccgccaagatttctgcagacagcttcactgggccatgaatcctccccagatggtgttt
gggcagccattacagtcagaaacaggagaagaatacatacttgataagctgcttaaagca
caagaatgtgacagtatgtcaacggaatactctgccttcctaacccgatgtttcatctgc
cgagttcgctgcctgctggacagcacttctggtttcctgacaatgcagtttcaaggaaag
ctcaagtttctgtttggacaaaagaaaaagacgccatcaggaacactcctgcctccccag
ctttcattgttttgtgtggtggtaccaatcctgctcccttctgtgacagaaatgaaaatg
aaaaatgtgcttctgagagccaagcagaaagccgatgtggcagcctccacggacgccaaa
gcaaaaactactgctggtctatgtgaatctgaactacaaggaagagcacatttccaagga
gtaaagaataatggagaaaatggtgtttctgtgttcaaagtacaagcaaatgatgatcac
tgggtctgggtacaagccaatgctcagctcctctacaggagtggttgttcagactatctc
ctaaacccacagacagtggcaaaggaagaggaagaacacctgaagatgtcaggaagtaca
accagtgggaaagggcgaagagaaccactaatgtataattgttccattgaaacattggga
cccatgaagcatctgaattggacagcagaaaaacatgatcaggatggtataaaactgaag
tttgaaccaaataaaactgacaaatgttttttacaagaggagggcctaagttcttgcatg
ccctatccaggagtccaaaacacatgtaatacaaacagtatttctcccttcagaagttca
tccaattctcaagctatgaattcacccctaagtgcctaccccaaccgaataattagacct
ttctataatggagatcaaagtcatttaaaccctccgtccagttgccatcctcatcaaggt
gggatggagaattgccagtcttgtcccggctttcagcatcttgctgtgggaagctatgct
tcagaaaatgtcaaattgcaaagtgcattgatacccccagaaactctatacaatcaaatg
ttaccattagatatacccatcaaaatggaaaatgattctgattctgataatggaatcgat
ggctaccccatttcacaaaaccaggtgtggctaggggaaagcaatgtggtcaagagacat
cttattagtttccctaacagggtgcattttaaaacagaaccagagttcaccgagcacttg
tctccttgtgaaaatcccaagcattatacttatccccctcaccatggacagtgtgttgtg
agcactcatcccaacaacagagccattagtagatccggtaaagagatctcaccattttac
tcaccaaactgtgcctatctggaacgcatgcatggcctacaagacacagaatactacaac
cacttgtacagtcccagttcaacaaatatgaagggacatactgagcatcagccttataag
ctacagtgtgattttaaagctcctggaatggttcagatgatcaagcgtgaacctttggat
tctcctccatgggctggtcatagccaaagtggggtgcaagtgatttttcctaaaaatgcc
ttatcgactcttatgcctcataaagctacagaatgcacattcttacaatag

DBGET integrated database retrieval system