KEGG   Phascolarctos cinereus (koala): 110209352Help
Entry
110209352         CDS       T05867                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00480  Glutathione metabolism
pcw00590  Arachidonic acid metabolism
pcw01100  Metabolic pathways
pcw04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110209352 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110209352 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    110209352 (GPX7)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110209352 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 110209352
NCBI-ProteinID: XP_020843445
Position
Unknown
AA seq 201 aa AA seqDB search
MLGRQTPCRPLPLVPLVPLLLFLLFLASPATPGPKESDFYNFKVVNIRGKWVSLEKYRGS
VSLVVNVASECGYTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNKEIENFARK
TYGVSFPMFSKIAVRGTGANAAFKYLIESSGEEPTWNFWKYLVAPNGKVVGAWDSTVSVE
EIRPKIHELVGKLILGKKDEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctcggccgccagactccttgccgccccctccccctcgtccccctcgtccccctcctc
ctcttcctcctcttcctggcctccccggccactccggggcccaaggagagtgacttctac
aacttcaaggtggtcaatatcaggggcaagtgggtgtccctggagaagtaccgcggctcg
gtgtcactggttgtcaatgtggccagtgagtgtggctatacagaccagcactaccgagct
cttcagcagctgcagcgagacctgggtccacaccatttcaatgtgttggcctttccttgc
aatcaatttggccagcaggagccagacaccaacaaggagattgagaactttgcccggaag
acctatggagtctccttccctatgttcagcaagatcgctgtccgtggtactggggccaat
gctgccttcaagtatctaattgaatcctccggggaagagccaacttggaatttctggaaa
tacctagtagccccgaacggaaaagtggtgggagcctgggactcaactgtatcagtggag
gagattcggcccaagatccatgagcttgtggggaagctcatcctggggaagaaggatgaa
ttataa

DBGET integrated database retrieval system