KEGG   Phascolarctos cinereus (koala): 110209808
Entry
110209808         CDS       T05867                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00230  Purine metabolism
pcw00240  Pyrimidine metabolism
pcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110209808 (DCK)
   00240 Pyrimidine metabolism
    110209808 (DCK)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     110209808 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 IIGP DUF932
Other DBs
NCBI-GeneID: 110209808
NCBI-ProteinID: XP_020844160
UniProt: A0A6P5KF27
Position
Unknown
AA seq 260 aa
MATPPKRSCPSPAAGAEGARIKKIAVEGNIAAGKSTFVNILKQVSDDWEVVPEPVARWCH
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLSALSGKLKEAE
RPVVFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQA
IPEKCLSRIYLRGREEEQEIPLEYLEKLHYKHESWLQNRTLKTNFDYLQEIPILTLDVNE
DFKDKHENLIEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgaccccgcccaagaggagctgcccgtcgcccgccgccggcgccgagggggcccgt
atcaagaagatcgccgtcgaaggcaacatcgctgcggggaagtcaacatttgtaaatatc
cttaagcaagtctctgatgattgggaagtggttcctgaaccggttgccaggtggtgccat
gttcagagcactcaagatgaatttgaggagctgaccacttctcagaaaagtggtggcaat
gtgcttcagatgatgtatgaaaaaccagaacgatggtcattcaccttccagacctatgcc
tgcctgagcagaatccgagctcagctctcggctctcagtgggaagctcaaagaggcagag
aggcccgtggtgttctttgagcgctcggtgtacagtgacaggtatatttttgcatctaat
ttatatgagtctgattgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccagagccttgaactggatggaataatttatcttcaagcc
attccagagaaatgtttgagtagaatatacttgaggggaagagaagaagaacaagaaatt
cctcttgaatacttagaaaagctccactataaacacgaaagctggctccagaatagaaca
ctgaaaaccaactttgattatctacaagagatacccatcttaacgctggacgttaatgaa
gattttaaagacaaacatgaaaatctcattgaaaaggtcaaggaatttttgagcactttg
taa

DBGET integrated database retrieval system