KEGG   Phascolarctos cinereus (koala): 110210716Help
Entry
110210716         CDS       T05867                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory guanylyl cyclase GC-D-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00230  Purine metabolism
pcw01100  Metabolic pathways
pcw04740  Olfactory transduction
pcw04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110210716
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    110210716
   04740 Olfactory transduction
    110210716
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110210716
Enzymes [BR:pcw01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110210716
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   110210716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Peripla_BP_6 DUF3987
Motif
Other DBs
NCBI-GeneID: 110210716
NCBI-ProteinID: XP_020845467
Position
Unknown
AA seq 1166 aa AA seqDB search
MATTLSVNTVRGDQSDILNLPDLHSRMCQRSQGGRCTRARGPWGTMTPEASLWNCLNGKT
LDLLCLQGIWLWLIRPLWGFPFSFVRAPWLVLLSVMLCCLVLGAPLSPNSTLDEDSFVVG
VLGPWECDLLFTKALPHVAAQLAITRAKKDFLLELDTRLDYVILEEGCNTAQALATFLSY
RGAVAAFVGPSSPGYCPAAALLGQNWGKALFSWACGAPESGGTLVPTLPSTIHVLLAVLK
HFGWAHVAVISSHQDVWVDTAQQVTSALRTHGLPVGPVTSLGPGGQGSVEALKQLQDTSR
LKVVVMCMHSALVGGSEQAVLLAQAHALGLTDGRYVFIPYDALLYGMPYRNRSYPVLRDG
SGLQEAYDAVLTISLESGTTDFDGAFSAARKNGEITVNTEPEQVSPLFGTIYDAIFFLAN
ALNHSKKQGGQLSGKYLQDHIISLDVAGFSQRIQTDERGNRLANYVILDTNGQKNQLIPT
HLLDTSTQLVQSLSRPIHFPRGXPPPPDSNCWFDPDTLCTGDGSSVPLLALISVSTLVLG
GLGLICLIRILQFHPGGGPNKIXLTLADLTFTHPRLSQQKLTLDSXSNXWSPSDGKSLSS
EVQSPGRVLPVTSETSNIALYQGDWVWLKKFKAGTFPELCQSSVKLLKKMRDLRHENVNI
CLGFFTDLGVSAIVFEHCCQGSLEDLLKNEALRLDWTFKSSLLMDLIKGIRYLHHRRFPH
GSLKSRNCVVDGRFVLKVTDHGYLALLERQRVPHFQSLPEELLWTAPELLREPERPCRGT
FKGDVYSFAIILQEVLARGPPYCTSGLSAEEIIRKVVSPPPLCRPVVSPDQGPPECIKLM
KQCWSEAPEDRPSLDDIFSQFKSINQGKKSSVSDCMLRLLEKYSHDLEDLVQARTEELEL
EKQKTEKLLSQMLPQSVAEALKAGTTVVPEYFDQVTIYFSDIVGFTTISALSEPIEVVNL
LNDLYTLFDSVLKSHDVYKVETIGDAYMVASGLPRRNGIRHAAEIANLALDILSSVGDFR
MRHVPEVPIRIRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMETTGLPYRIHVNRST
VQTLVSLNEGYIIEVRGQTELKGKGIEETYWLVGKAGFPKELPKPMDIKPGDAWQEMVNQ
EIKASFSKASQSDGRPRSSKKAEPGP
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaccctttctgtgaatactgtcagaggggatcagagtgacatcctcaatctg
cctgatcttcactccagaatgtgccagcgctctcagggcggacggtgcaccagggccagg
ggaccatgggggaccatgacacctgaagcctctctctggaattgtctgaatggaaagacc
ctggaccttctttgccttcagggtatatggctgtggcttatcagacccttatggggtttt
cccttcagctttgtgagggccccttggctggttttactcagtgtcatgctatgctgtctc
gtcctaggtgctcctctgagccccaactcaacactggatgaggattctttcgttgtgggg
gtgctgggtccatgggagtgtgacctcctcttcaccaaagcccttccccatgtggctgcc
cagctagccatcacacgagccaagaaagacttcttgttggagctggacacccgacttgat
tatgtgatccttgaggagggctgcaatactgcccaggccctggctactttcctctcctat
agaggtgctgtggctgcctttgtggggccttccagtcctggctactgcccagcagcagca
ctcttgggccagaactggggcaaggcccttttctcctgggcatgtggggctccagagtct
ggaggcacattggtccccacgttgccctctaccatccacgtcctgttagcagtcctgaag
cactttggctgggctcatgtggctgtcatatcctcccaccaggatgtctgggtggacaca
gcacaacaggttacctcagctctcaggactcatggattgcctgtggggcctgtaacctct
ctggggcctggaggccagggatctgtagaagccctgaagcagctccaagacacaagtagg
ttgaaggtggtggtgatgtgcatgcattcggctcttgttggtggctctgagcaggcagtc
ctgcttgcccaagctcatgcacttggactgactgatggcaggtatgtcttcatcccatat
gatgcactgctttatgggatgccctatcgaaaccggtcctacccagtgctgagggatggc
agtggccttcaggaagcatatgatgccgtgctgactatcagtctggagtccggtaccacc
gactttgatggagccttctcagctgcaaggaagaatggggaaatcactgtcaacacagag
cctgagcaagtgtccccactctttgggactatctacgatgccatcttttttctggccaac
gctctgaatcactctaagaaacaaggaggtcaactctcaggaaaataccttcaggatcac
attatatctctggatgtggctggttttagccagaggattcagacagatgagaggggaaat
aggttggccaactatgtgatcttggatacaaatggtcagaagaaccagcttattccaacc
catttgctggacacatccactcaattagtacaatcactcagcagacctattcactttcca
cgagggngaccacctccccctgactccaactgttggtttgatccagatactctgtgcaca
ggagatgggtcttcggttcccctcttggctttgatatcagtatccaccctagtgcttgga
ggcctggggctcatttgcctcatcaggattctgcagttccatcctggaggaggccccaac
aagattntgctgaccctggcagacctcactttcacccatcctcgactgagccagcagaaa
ctcaccctggactccngtagcaactaatggagcccctcagatggcaagagcctcagctca
gaggtccagtctccagggagggtcctcccagtcacatcagagacttccaacattgccttg
taccagggagattgggtttggctgaagaagttcaaggctggaacattccctgagctctgt
cagagttctgtgaagctactgaaaaagatgagagacctgagacatgaaaatgtgaatatc
tgcctgggcttctttactgatctgggtgtttctgccattgtgtttgagcattgctgccag
ggcagtttggaggacctgctgaagaatgaggccctgcggcttgactggactttcaagtca
tccctcctgatggatttgattaaaggtatccggtatctccaccatcgaaggtttccccat
ggttccctcaagtctcgcaactgtgttgtggatgggcgctttgtgctcaaggtcacggac
catggctatttggcactcttggagaggcagcgagttcctcatttccaatccctgccagaa
gagttgctgtggactgcaccagaattgctcagggagcctgaaaggccttgtagaggcact
tttaagggggatgtctacagttttgccatcattttgcaagaggtgctagctcgaggacca
ccctactgcacgtcaggactctctgcagaagaaatcatcaggaaggtcgtgtctcctcct
cccctctgccgtccggtggtgtctccagaccagggaccacccgagtgcatcaagctgatg
aaacagtgctggagtgaggctccggaagacagacctagcctggatgacatcttcagccag
tttaaaagtatcaaccagggcaagaagagcagtgtgtctgactgcatgctgcggctactg
gagaagtactcccatgacctggaggacctggtccaggcgaggacagaagaactggagctg
gagaaacagaagacagagaagctgctctcacagatgcttccccagtctgtggcagaggca
ctgaaggctgggaccactgtggtcccagagtattttgaccaggtaaccatctacttcagc
gatatcgttggcttcaccaccatctcagctctgagtgagcccatcgaggtggtgaacctg
ctcaatgacctctacacgctgtttgattctgtcctgaagagccatgacgtgtataaggtg
gagaccattggtgatgcctatatggtggcctccgggctgcctaggcggaatggcatccgg
catgcagctgaaattgccaatctggcgctggacatcctcagctctgtgggtgacttccgc
atgaggcatgtgcctgaggtgcccatccgcatccgggctggcctgcactcagggccctgt
gtggcaggcgttgtgggcctcaccatgcctcgctactgcctctttggagacacggtaaac
actgcctcccggatggagactacgggattgccttacaggatccatgtcaaccgaagtacc
gtccagaccttggtcagcctgaatgaaggctacatcattgaagtcagaggccagactgaa
ctgaagggcaaaggtatagaagaaacctattggctggtcgggaaagcgggcttcccaaaa
gaactccctaagcccatggatatcaaaccaggagatgcctggcaggaaatggtgaatcaa
gagatcaaggcatccttcagcaaggccagccaaagcgatggcagacccagaagttccaaa
aaggcagaaccaggcccctag

DBGET integrated database retrieval system