KEGG   Phascolarctos cinereus (koala): 110210897
Entry
110210897         CDS       T05867                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110210897 (RDH5)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110210897 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776
Other DBs
NCBI-GeneID: 110210897
NCBI-ProteinID: XP_020845612
UniProt: A0A6P5KKV1
Position
Unknown
AA seq 318 aa
MWPLLFLGTLLWGILWFLRDRQVLPPSDAFIFITGCDSGFGRHLALRLDRRGFRVLAGCL
TPTGAENLKRAASPRLCTTLLDVTDPQNIQQVAEWVGTIVGERGLFGLVNNAGVTGIIGP
TPWLNLEDYRRVLEVNTLGPIGVTLALLPLLQQSQGRVINITSVLGRLAANGGGYCVSKY
GLEAFSDSLRRDIAPFGVRVSIVEPGFFRTAVTNLECVEGTLQASWKRLSPATQASYGDN
FLPKYLKVQRFIMNLICDGDLGKVSSCLEHALTACYPRTRYSPGWDAKLLWLPASYLPAS
LVDAILTCVLPKPAQTVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggccgctcctgtttcttgggaccctgctttggggaatattgtggttcctgcgagac
cggcaagtgctaccccccagtgatgccttcatattcatcactggctgtgactcgggcttt
ggccggcacctggcgctgcggctggacagacgaggcttccgagttctggctggttgcctg
acacccacaggggcagaaaacttgaagcgggctgcttctcctcgactctgcaccacgctc
ctggatgtcactgacccccaaaacatccagcaagtggctgagtgggtggggacgatcgtg
ggagagagagggctctttgggctggtgaataacgcaggcgtcactgggatcatcggtcct
accccgtggctgaatctggaggattaccggagagtactcgaagtgaacacactgggtccc
atcggagtgacccttgccctgctgcccttgctacaacagtcacagggtcgagtcatcaac
atcacctccgtcctgggccgtctggctgccaatggtgggggctactgtgtctccaaatat
ggcctggaggccttttctgacagcctacgacgggacatagctcccttcggggtacgggtc
tctatcgtggaaccaggcttcttccgcacagcagtgaccaacttggagtgtgtggagggg
acgcttcaggcctcctggaaacggttatctcctgccactcaggccagctacggggacaac
ttcctccccaagtacctgaaggtacaacggttcatcatgaacctgatctgtgacggggac
ttgggcaaggtgagcagctgcctggagcatgcactgactgcctgctacccccgcacaaga
tacagtcctggatgggatgccaagcttctctggctgcctgcctcctacttacctgccagc
ctggtagacgctatactcacttgtgttcttcccaaacctgcccagactgtctgctga

DBGET integrated database retrieval system