KEGG   Phascolarctos cinereus (koala): 110212707Help
Entry
110212707         CDS       T05867                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase 1-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00232  Caffeine metabolism
pcw00983  Drug metabolism - other enzymes
pcw01100  Metabolic pathways
pcw05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110212707
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110212707
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110212707
Enzymes [BR:pcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110212707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 DPPIV_N
Motif
Other DBs
NCBI-GeneID: 110212707
NCBI-ProteinID: XP_020848374
Position
Unknown
AA seq 289 aa AA seqDB search
MDIREYFARIGYNHSGEKSDLETLIEVMLHHVQAVPFENLDIHCGIPISLSLEAVYDKIV
RRKRGGWCLEVNHLLFWVLTTMGYDTTILGGYVYNTIKRQYSTMIHLLLKVTIGEKAYIV
DGAFGRSHQIWQPMELVSGKDQPQTPCIFRLKEDNGIWYXDQLRRKQFIPNPEFQNSDLL
EKNEFRHIYSFTLQPRTIEEFESANIYLQTSPKSVFTSKSFCSLQTVDGIYCLVGWTLSH
RRFNYKENMDLVEFKILEYEDIEKILKDIFNICLEKKLVPKHGDRFFTI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggacatcagagaatactttgcaaggattggctataaccattccggtgagaagtcggac
ttggagactttaattgaagtgatgctgcatcatgtccaagctgtgccttttgagaacttg
gacattcactgtggaatacccatatcactgagcttagaggctgtgtatgacaagattgtg
aggaggaagaggggtgggtggtgtctagaagtcaatcaccttctcttttgggtcttgacc
acaatgggctatgacactacaattttagggggatatgtttacaataccataaagaggcag
tatagcactatgattcacctgctcctaaaggtcacaataggtgagaaggcctatatagtg
gatggtgcgtttggcaggtctcatcaaatatggcagccaatggaactggtttctggaaag
gaccaacctcagactccttgcatcttccgcttgaaagaagataatggaatctggtacntg
gaccaactaagacggaaacaattcattccaaacccagaatttcaaaactccgatctcttg
gaaaaaaatgaattccgtcatatctactcttttactctccagccacgaacaatagaagaa
tttgaatctgcaaatatctaccttcagacttctcctaagtctgtgtttacaagcaagtct
ttctgttctctgcagacagtagatggaatttactgtttagttggctggactcttagtcac
agaagattcaattacaaggaaaacatggatttggtggagtttaagattctggagtatgaa
gatattgagaagatcctgaaggatatattcaatatctgccttgagaaaaagcttgtccca
aagcatggtgacagattttttaccatttag

DBGET integrated database retrieval system