KEGG   Phascolarctos cinereus (koala): 110212769
Entry
110212769         CDS       T05867                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pcw03021]
    110212769 (AFF3)
Transcription machinery [BR:pcw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     110212769 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 110212769
NCBI-ProteinID: XP_020848509
Position
Unknown
AA seq 1341 aa
MDSFDLALLQEWDLESLCVYEPDRNVLRRKERERRNQETQQDDGAFSTSYSLFSEPYKHI
CFFPLQTNKGDELSNRIQNTLGSYDEMKDFLTDRSNQSHLVGVPKPGVPQTPMNKIDEHF
IADSRPQPQPPICSTSSSTPAAVPVQQSKRVTMGWQKVGHPTSDGQQRASKHGHRLLDSH
NSDFKSANQKTSNEKPKHCVSSPTSSSSSSSSSSSSSSNSAQPGPPRTMLGDSVSRQQSR
SKQSCSVEMGLQPQERTSTMSAKHSSGGHCVQNFPPSLASKPSLIQQKPTAYVRPMDGQD
QAPDESPKLKSSTDTSVHCASYRGVPVNKAESSRTKSKLAKFSIPKQGEDSGSGDNSCVE
EILREMTHSWPPPLSAIHTPGKLEPSKFSFPNKDSQHVSTGHNNPKKGDAEPKSPDNGTS
NTSMLEDDLKLSSDEEENEQQAAQRSALRVLSDSAVVQQQANSGPSGPSSKGSSSGSSSS
SSSSSSDSESSSGSDSESESSSSGSEGSKPSHYSSPEPEQASSNKWQLDKWLNKVNPHKP
PLLNQNESHGSEGSQYYNRGKDEVQECGKLSTLCQTGLREKEIKTACKEEQRPRTANKAP
GTKGVKQKSPPATAPAPPAAAAAPTAPPAAPAVVPAALSSGPVGAAPVASEGAGAPPPPR
RSACKKPQRRTTTTTTTTTTTTTTTTERASASEGASCHRPAAEELAASEVLVESPAPEPP
KPRPCGGGARTGHRKELRSCSAAAAAAAAACEKRRTRGLSKTAPKSKEFIETESSSSSSS
SSSSSDSEPESEQEDCPGPKPTAGGPAPSSASAGGDQRLREGGPGNGGSNNGNKAVGSIN
ARTSSDAAKELEEQFYTLVPFGRNELLSPLKDSDEVKALWVKIDLALLSRIPEPSPPQEA
ALAAPGAKETEPGLQNAAPDLPPAEKGLPKSKRKRKCENEEEFREIKKTQGEKECSSRLT
TLASSTSSTSHCHLNTNSLAIPINKNEKMLRSPISPLSDVSKHKYSNDDLTSSSRPNGSS
LFTSISSSKKHKTENQLQPHAGDLAKTVHNSSENILFYNKPRPQTEPWSPLSNGHRDCRR
QKLIFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMES
KSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVK
YSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPSPSPVSSVGSQGSLSSTSTPSPS
SIISIPHRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSM
EHLVQYSQQGLHWLRNSVHSS
NT seq 4026 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgcttcaggaatgggacttggagtctctgtgtgtctat
gaaccagacagaaatgtgttacggaggaaagaacgggaaaggaggaatcaggaaactcag
caggatgatggtgcatttagtacaagttactccctcttcagtgaaccttacaagcatatt
tgcttttttcccctccagactaacaagggggatgagctctcaaatcgaatccagaatact
ttaggcagttatgatgaaatgaaagacttcttgactgaccgatctaatcagagtcacctt
gttggagttcccaaacctggggttccacagacccctatgaacaaaatagatgagcatttc
attgctgactcaagaccgcaaccccagcctcctatctgcagcacatcatcttccacacca
gcagctgtacctgtgcagcagagcaagagggtcaccatgggctggcagaaagttgggcat
cctacatctgatggccagcagagggcaagcaaacatgggcatagattgcttgattcacac
aatagtgacttcaaatctgctaaccaaaaaaccagtaatgagaaacctaaacactgtgtc
tcaagccccacatcctcttcctcctcctcctcttcttcctcttcttcctcctccaactca
gcacaaccaggacctccaaggaccatgcttggagacagtgtcagcaggcagcagtcacgg
tccaaacaaagctgcagtgtggaaatgggtctccaacctcaagaaaggacatctaccatg
tctgccaagcacagcagtggtgggcactgtgttcagaacttccctccttctcttgcttca
aaaccaagtctaatccagcagaaaccaactgcttacgttcggccaatggatggccaagac
caggcccctgatgaatctcctaaactcaagtcttcaacagacactagcgtacattgtgca
tcctaccgaggagtacccgtcaataaagctgaatcatccaggaccaagtccaagctagca
aaatttagcattcccaaacagggagaggacagtggatcaggcgataacagctgtgttgaa
gaaatattacgggagatgacccattcttggcctccacctctttctgctattcacacacct
ggtaaattagaaccaagcaagttttcatttccaaataaggactctcagcatgtatccact
ggacacaacaatccaaagaaaggtgatgctgagccaaagagtccggacaatggtacatca
aatacttcaatgctagaagatgaccttaagttaagtagtgacgaagaagagaatgagcag
caggccgcacagagatctgctctccgcgttctgtctgacagcgcggtggttcagcagcag
gccaatagcggaccctccggcccctccagcaaggggtcgagcagcggcagctccagcagc
agcagcagcagctccagcgactcggaaagcagctccggctcggactcggagagcgaaagc
agctccagtgggagtgaaggcagcaagccttctcactactccagcccagagccagaacaa
gcttcttccaacaagtggcagctggataaatggctcaacaaagtgaatccccataagcct
ccactcctgaaccaaaatgagagccacgggtcagagggcagccagtactacaaccgggga
aaggatgaagtgcaggagtgcggaaaattaagcaccctctgccagacaggcctcagagag
aaggagatcaagaccgcctgcaaagaggagcagaggcctaggactgctaacaaggcccct
gggactaaaggggtgaagcaaaaatcgcctcccgccactgcgcctgcgcctcccgcagcc
gcagccgcccccacagcgccccctgccgccccggccgttgtccccgctgctctgagctca
gggcccgtgggggccgccccagttgcttcggagggtgcaggcgcgccgcccccgccccgg
aggtcggcctgcaagaagccccagaggaggactacgacgacgacgacgactacgacgacg
acgacaacgacgacaacggagagggcctcggcaagcgagggcgccagctgccaccggcct
gcggccgaggagctggcggccagcgaggtgctcgtggagagcccggcccccgagcccccc
aagcccaggccgtgtggcggtggcgccaggacgggccaccgaaaagagctgcgctcgtgc
tcggccgcggcggcagcggcggctgcggcctgcgagaagcgccgcacgcggggcctgagc
aagacggcccccaagtccaaggagttcattgaaactgagtcgtcgtcctcgtcttcgtcc
tcgtcgtcctcgtccgactcggagccggaatcggagcaggaggactgtccgggccccaaa
cccacagcggggggcccggcgccctcgtcggcctcggcggggggcgaccagcggctccgg
gagggcggccccgggaacggaggcagcaacaacggcaacaaggccgtgggctccatcaac
gccaggacctcgagcgacgccgccaaggagctcgaggagcagttctacaccctggtgccc
tttggccgcaacgagctgctctccccgctcaaggacagcgacgaggtcaaggccctctgg
gtcaaaatcgatctggccctcttgtcccggatcccagagccctcgcccccccaggaggcc
gccctggctgcccccggggccaaagagacagagcccggcctgcagaatgcagccccggac
ctgccgcccgccgagaagggattgccgaagtctaagcggaaacgcaagtgtgaaaatgag
gaggaatttagggagatcaagaagactcagggagagaaagagtgttcctcacgactgact
acattggccagcagtacttcatcgacaagccattgccacttgaacaccaacagcttggca
ataccaataaataaaaatgagaaaatgcttcggtcacccatttcacccctctcagatgtg
tcaaaacacaaatactccaatgatgatttaacttcttccagtagacctaatggcagcagt
ctgttcacttccatctcctccagcaaaaaacataagacggagaatcagttgcagccccat
gctggagaccttgctaaaacagtgcacaacagctcagaaaacattctcttctataataaa
ccacgaccccagacagaaccatggtcaccattatccaatgggcacagagactgcaggaga
caaaagctcatctttgatgatatgccacgcagtgcagattattttatgcaagaagccaaa
cggatgaaacataaagcagacgctatggtggaaaaatttggaaaagctttgaattatgct
gaagcagccttgtcatttattgagtgtggaaatgcaatggagcaaggcccaatggaatct
aaatctccctatacaatgtactcagaaacagtagaactcatcaggtatgctatgagacta
aaaactcactcaggcccaaatgccactccagaggacaaacaattagctgcattgtgttat
cgctgtctggctctcctgtattggcggatgtttcgactcaaaagggaccatgctgtaaag
tattcaaaagcacttattgactatttcaagaattcatctaaagctgcccaggccccatct
ccatggggtgccagtggaaagagcacaggaactccatcccccatgtctcccagcccttct
ccagtcagctcggtgggatctcaggggagtctctcaagcactagcaccccttcgccatca
tccataattagcattccacataggatccatcagatggcagccaaccatgtcagcatcacc
aacagcattctgcacagctatgactactgggagatggcagacaaccttgccaaggagaat
agagagttctttaatgatctggatttgctgatggggcccgtcaccctgcatagcagtatg
gaacacctagttcagtactcccagcaaggactgcattggctgcgaaatagtgttcactcg
tcatag

DBGET integrated database retrieval system