KEGG   Phascolarctos cinereus (koala): 110214361Help
Entry
110214361         CDS       T05867                                 

Gene name
PARP10
Definition
(RefSeq) poly [ADP-ribose] polymerase 10 isoform X1
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110214361 (PARP10)
Enzymes [BR:pcw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110214361 (PARP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Med11 PTS_2-RNA
Motif
Other DBs
NCBI-GeneID: 110214361
NCBI-ProteinID: XP_020850907
Position
Unknown
AA seq 927 aa AA seqDB search
MTELGSEVQVELRGLPHAVSDELVILYFQNRRRSGGGPLRGWQRLDGGGILTFQKSEDAQ
RVLAQASHVLQGTAVSVVPSPPRAPQRLLFLGLRPGTTPELLEYYAESLLSTEGECQALA
SPRPDRALVQLPTPLSEAEFEELATRSSGKTLGGTKVSLAWVPQARAVRVVRRDQPPDPT
LLQLYLENPRRSGGGALEGLRTLPRAQGTVVTFQQWEVAERVLSQNHQLGDSELNIVPHY
DVLEPEPEPEPKPEEGDRPALGEMISTETFGKIVPMEGLEATMTIKKPGITLPVENAMAT
VPLEKMEATGSRETPEESVTVERAGAVEPLGSIVLEETVPGERSREPVGDTVPKKVVPGE
GGEILLPMEPGALRFLQLYYQEFLASLSEVTLCSLDGPDVTGFQINGAQESCQAAKDFLQ
SLLGSIECHMLPLKHPGSAHFLLGSEGQSLLKDLEAQFHCILTVEQQVVAAFDVDPVELD
PTNPLESPEDWAYDPPPSSSTASDTSAIQMEEIKKFLDTLDEEECPLLEMEEGELHESEE
GVAAPGRTKETLEEEAALQLALHHSLEEKSLMMWETRTLKQVLMMSLLDDREPDGSGSSH
SRGRLMVHVACDQDPSELSQVLETVLREQLREERVMGVDQHLPPAFWSRLGRHHDVTVIL
QGRCAVLSGYGPQPSCAANHLRELMTVPLSQSYTLAPDSARPEVVPQVMGQQPLELECLE
ESSEEFQETAQAFYSTLDSSRSKIRIVKVERVSNPLLQSQYELHKKKLEQSCLQQPIERI
LYHGTSWQAVPDICSQGFNRSFCGRNATLYGKGVYFAVQAKVSIKDRYSPPDANGHKAVF
VARVLTGDYGLGRPELRVPPQRDTGQGIQRYDSAVNSTRKPRIFVIFHDTQALPIFLITC
QCIPDPSILNNDSCSGLSTHSPSPPPY
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctggggtccgaggtgcaggtggagctgcggggtctgccccacgccgtgagt
gacgagctagtgatactgtatttccagaaccggcggcgctcggggggcggccctctgaga
ggctggcagcggctggatggtggcgggatcctcacctttcaaaagtcagaggatgctcag
cgagtcctggcccaggccagtcacgtgctgcagggcacagctgtgagtgtggtgccttcc
ccaccccgggccccccagcgtctgttgttcctgggcctgaggccgggcacaaccccagag
ctcctggaatactatgcggagagcctcttgagcaccgaaggggagtgtcaagccctcgcc
agtccgcggccagaccgggccctggtacagttacccacgcctctctcggaagcagagttt
gaagagctggctactcggtccagtgggaaaacactgggaggcacaaaggtgtcactagcg
tgggtgccccaggctcgtgctgtaagggttgtgaggagagatcagcccccagatcccaca
ctacttcagctctacctggagaaccctcgccgcagtgggggcggtgccctggaggggctg
cggacactacctagggcccagggaactgttgttactttccagcagtgggaggtggcagag
cgagtgttgagccaaaatcaccaacttggcgattcagagctaaacatagtcccccactat
gatgtcctggagcctgaacctgagcctgagcctaaaccagaggaaggagatagaccagct
ctgggagagatgatttccacagagacctttggaaaaatagtgcctatggagggactggaa
gccacaatgactataaagaaaccagggataacactgcctgtggagaacgctatggcgacg
gttcccttggagaaaatggaggcaacaggatctagggagacaccagaggaatcagtgact
gtggagagagcaggggcagtagaacctctgggaagcatagtgctggaagaaactgtgcca
ggggagagatcaagagagccagtgggggacacagtgcccaagaaggtggtgccaggggag
ggaggggagatcctgctgcctatggagccaggtgccttgcgatttctgcaactctactac
caggagtttcttgccagccttagtgaagtgaccctttgctcactggatggtccggatgtc
actggctttcagatcaatggggcacaggagtcatgccaagctgccaaagacttcctacag
agtcttctgggcagcattgagtgccacatgctgcctctgaaacacccaggcagtgcccac
ttcctgctgggcagtgagggccaaagcctcctgaaggacctggaggcccagttccattgc
atcctcacagtagaacaacaggtggtagcagccttcgatgtagaccccgtagagcttgac
cccacgaaccctctagagtcaccagaagactgggcctatgaccccccaccctctagcagc
actgcttcagacacttcagctatccaaatggaggagatcaagaagtttctggacacccta
gatgaagaagaatgtcctctcttggagatggaggagggggaactgcatgagtctgaggag
ggggtagcagcccctggcagaacaaaggagacacttgaggaggaggcagctctgcaattg
gccctgcatcattcactggaggagaaaagcctgatgatgtgggagacaagaactctgaag
caagtgctgatgatgtctctgctggatgacagagagcctgatggcagtggtagtagtcac
agtagggggagactcatggtgcatgttgcctgtgatcaggaccccagtgagctgagccaa
gttttggagactgttctcagggaacagctacgagaagagagggtgatgggtgtggaccag
catttaccccctgcgttctggtcccgcctggggaggcaccatgatgtgacagttatcctg
cagggaaggtgtgctgtcttaagtggctatggtccccagccttcctgtgctgccaatcac
ctcagagaactgatgactgtccccttgagccagagctacacattggccccagactctgcc
agaccagaagtggtgccacaggtgatggggcagcagcccttagagctggagtgcctggaa
gagagcagtgaggaattccaggagacagcccaagccttttacagcaccttggacagctcc
cgcagcaagattcgcatcgtcaaggttgagcgggtgtctaatcccctactccagagtcag
tatgagctccataagaagaagctggaacagtcatgtctgcagcaacccatcgagcgaatc
ctgtaccatgggacctcttggcaagctgtgcctgatatctgcagccaaggcttcaatagg
agcttctgtggccgcaatgccaccttgtacgggaagggggtgtactttgctgtacaggct
aaggtctccatcaaggaccggtactcacccccagatgccaacgggcacaaggcagtgttc
gtggctcgagtgctgacaggagactacgggctaggacgtccagagcttcgggttccaccc
cagagggacactgggcagggcatccagcgctatgacagtgctgtcaactccacaagaaag
cctagaatttttgtcatcttccacgacactcaggccttacccatcttcctcatcacctgt
cagtgtataccagaccccagcatactcaataatgatagctgcagtggccttagtacccac
tctccatcacctcccccctattga

DBGET integrated database retrieval system