KEGG   Phascolarctos cinereus (koala): 110214977Help
Entry
110214977         CDS       T05867                                 

Definition
(RefSeq) stromelysin-1-like
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04657  IL-17 signaling pathway
pcw04668  TNF signaling pathway
pcw05202  Transcriptional misregulation in cancer
pcw05215  Prostate cancer
pcw05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110214977
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    110214977
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110214977
  09162 Cancer: specific types
   05215 Prostate cancer
    110214977
  09163 Immune disease
   05323 Rheumatoid arthritis
    110214977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pcw01002]
    110214977
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     110214977
Peptidases [BR:pcw01002]
 Metallo Peptidases
  Family M10
   110214977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Astacin Reprolysin_4 Reprolysin_5 DUF4953 Peptidase_M54 Metallopep
Motif
Other DBs
NCBI-GeneID: 110214977
NCBI-ProteinID: XP_020851806
Position
Unknown
AA seq 477 aa AA seqDB search
MRSLPVLLLYLAFSAAYPLDPAATVGKLSMDRVQKYLEDFYHLEKNVNQFVRMKSSSPVV
AKIREMQRFLGLKVTGNLDDDTMEMMKKPRCGFPDVSSYAFFPYMSKWKKNEVTYRIVNY
TTDMKQTDVDTAIERALKVWSDVTPLTFTRLDEGEADIMISFAVKDHGDFLPFDGPGGVL
GHAYPPGPKINGDVHLDDDEKWTEDKSGVNLFLAVAHEFGHSLGLAHSSDTRALMYPVYD
INTDLTKFRLSQDDIDGIQSLYGYPSVPPTTSTENETLEKDPATCDPNMSFDAVSTLRGE
MLFFKDKYFWRKSTNSIEPTLCLLSAYWPSLPSGFDAAYELTTKDTVFVFKESKFWAVRG
SDIQPGYPRDIYTLGFPRTVKKIDAAFFHKEKQKTYFFVNDIYWRYDEKRHAMDHGYPRQ
IATDFPGVDEKVDAVFEAFGFFYFFSGSSQIEFDPNAQMVTRTLKSNSWFNCEERLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtcttccagttctcctgttatacctggcattttctgcagcctaccctctggac
ccagcagccacagttggaaaactgagcatggatcgtgtccagaaatacctggaagacttc
taccaccttgaaaaaaatgtgaatcagtttgttcgtatgaagagcagtagccctgtcgtt
gcaaaaatacgagagatgcaaaggttcttaggcttgaaggtgactgggaatttggatgat
gatactatggagatgatgaagaagcccagatgtggatttcctgatgtttcttcttatgct
ttctttccctatatgtctaaatggaaaaaaaatgaggttacgtacaggattgtgaactac
acaactgatatgaaacaaactgatgtagacactgccatagagagagctctgaaagtctgg
agtgatgttactcccctcacattcaccaggctcgatgaaggagaggctgacataatgatc
tcttttgctgtaaaagatcatggagattttctaccctttgatggacctgggggagtcttg
ggtcatgcctatccacctgggcctaagattaatggagatgttcacctggatgatgatgaa
aaatggacagaagataagagtggagtcaatttattccttgctgttgctcatgaatttggc
cattcgctgggtctcgcacattctagtgataccagagctctgatgtacccagtctacgac
ataaacacagacctcactaagttccgcctttctcaggatgatattgatggcattcagtct
ctctatggatatccatcagtaccacctaccacatctacagaaaacgagacacttgaaaag
gacccagcaacttgtgacccaaacatgtcttttgatgcagtgagcactcttcggggagaa
atgttgttctttaaagacaagtacttttggcggaagtccaccaacagtatagagccgaca
ctctgtttgctgtctgcttattggccctctcttccatcgggttttgatgctgcctatgaa
ctcactaccaaggacacggtttttgtttttaaagaaagcaagttctgggctgtcagagga
agtgacatccagccaggttacccgagagatatctatactctgggctttccacgaaccgta
aagaagattgatgcagcatttttccacaaagaaaaacaaaaaacatatttctttgtgaat
gacatttactggaggtatgatgaaaagagacatgccatggaccatggctatcccagacag
atagcaactgattttccaggagttgacgagaaggtcgatgctgtttttgaggcatttggg
ttcttctatttcttcagcggatcctcccagattgaatttgatcctaatgctcagatggtg
accagaaccctgaagagtaacagctggtttaattgtgaagagagactgtcataa

DBGET integrated database retrieval system