KEGG   Phascolarctos cinereus (koala): 110220167Help
Entry
110220167         CDS       T05867                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04260  Cardiac muscle contraction
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04921  Oxytocin signaling pathway
pcw05410  Hypertrophic cardiomyopathy (HCM)
pcw05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pcw05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110220167 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110220167 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110220167 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    110220167 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    110220167 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    110220167 (CACNG7)
   05414 Dilated cardiomyopathy (DCM)
    110220167 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110220167 (CACNG7)
Ion channels [BR:pcw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110220167 (CACNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 L_HMGIC_fpl Amastin Claudin_3 Serinc
Motif
Other DBs
NCBI-GeneID: 110220167
NCBI-ProteinID: XP_020859748
Position
Unknown
AA seq 275 aa AA seqDB search
MSSCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQSTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSGSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHMHISTSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgtgcagcagccgcgcgctgaccttgctgagcagcgtgttcggcgcctgcggc
ctcctcctggttggcatcgcggtcagcaccgactactggctctacatggaggagggcaca
gtgttgccccagaaccagagcaccgaggtcaagatggcgctgcacgccggcctctggagg
gtctgcttcttcgcaggccgggagaagggtcgctgtgtggcctcggaatatttcctagag
ccggagattaacctggtgaccgagaacaccgagaacatcctgaagactgtccgcaccgct
acccccttccccatggtgagccttttcctggtcttcacggccttcgtcatcagcaacatt
ggccacattcgccctcagaggactatcctcgctttcgtttctggcatcttcttcattctc
tcaggcctctccctcgttgtgggcctagtcctctatatctccagcattaatgatgaggtg
atgaatcgtcccagcggatctgagcagtactttcactatcgctatggctggtcctttgcc
tttgcggcctcctccttcctgcttaaagagggggctggcgtgatgtcggtctatttgttc
accaaacgctatgcggaggaagagatgtaccggccccacccggccttctaccggcccagg
ctcagcgactgctccgactattctggccagttcctccagcccgaggcctggcgccgaggc
cgcagcccctcggacatctccagcgacgtctccattcagatgacccagaactatcctcct
gctatcaagtacccggaccacatgcacatctccacctcgccttgctga

DBGET integrated database retrieval system