KEGG   Phascolarctos cinereus (koala): 110220332Help
Entry
110220332         CDS       T05867                                 

Gene name
METTL3
Definition
(RefSeq) N6-adenosine-methyltransferase 70 kDa subunit
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcw03019]
    110220332 (METTL3)
Enzymes [BR:pcw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     110220332 (METTL3)
Messenger RNA biogenesis [BR:pcw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     110220332 (METTL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 110220332
NCBI-ProteinID: XP_020860029
Position
Unknown
AA seq 580 aa AA seqDB search
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDPRNPEAVLSPTFRSDSPVPMTPTSSG
PKPSTASGTPELATDPELEKKLLHHLSDLALTLPTDAVSIRLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVSEKKGLGEVTGASTGQKRRA
EQDPTTATTFTSSSTSGLASSTSEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACIDAEAPGSSDHPPSQELALTQGVG
ADSSVDRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNRGLDCEVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNM
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacacatggagctctatccaggcgcacaagaagcagctggactccctgcgggag
aggctgcagcggcggcggaaacaggactcggggcacctcgatcctcggaacccagaagca
gtgctgtcaccaacctttcgaagtgacagtccagtacccatgacacccacctcaagtggc
cctaaacccagcactgcttcaggaactccagagctcgccacagaccctgagctggagaag
aagttattacaccacctctcagacctggcgctgacactacccactgatgctgtgtccatc
cgccttgctatctctacgccagatgcccctgcaacacaagatggggtggaaagccttctg
cagaagtttgcagcacaagagttgattgaagtaaagcgaggccttcttcaagatgatgcg
caccccaccctggtgacctatgctgaccattccaaactctcagccatgatgggggctgtg
tcagagaagaagggccttggggaagtgacaggggccagcacagggcagaagcggcgagcg
gagcaagaccccaccacagctactacatttaccagctcctcaacctctggtctggcctcc
tcaacctcagagccagccaaagagccagccaaaaaatcacggaaacatgctgcttctgat
gtggacctggaaattgagagtctcttgaatcagcagtctaccaaggagcaacagagcaag
aaggtgagtcaggagattttggaactgctaaatacaacaacagccaaggaacagtccatt
gtggagaagttccgctctcgaggacgggcccaggtacaagagttctgtgactatggcacc
aaagaggagtgcatgaaggccagcgatgctgaccggccctgccgcaagttgcatttcagg
cgaatcatcaataaacatacagatgaatcattaggtgactgctccttcctcaacacctgt
ttccacatggacacttgcaagtatgtacattatgagattgatgcctgcatagatgctgag
gcccctggcagctcggaccacccccctagtcaggaacttgcccttacacaaggtgttggt
gctgactccagtgtggatcgactcttcccaccccagtggatctgttgtgatatccgctac
ttggatgtaagcatcttggggaagttcgcagtggtaatggctgacccaccctgggatatt
cacatggagttgccatatggtaccctaacagatgatgagatgcggagactcaacatccca
gtgcttcaggatgatggctttctctttctctgggtcacaggcagagccatggagctgggc
agagaatgtctgaacctctgggggtatgaacgggtagatgagattatctgggtgaaaaca
aatcagttgcaacgtatcatccgaacagggcgtacaggccattggcttaaccatgggaag
gagcactgtttggttggtgtcaaaggaaatcctcaaggcttcaaccggggcctagattgt
gaagtgattgtagctgaggttcgctctaccagccacaaaccagatgaaatctatggaatg
atagagaggctgtcccctgggacccgcaaaattgagttatttggacgaccacacaacgta
cagcccaactggatcacccttgggaaccaacttgatgggattcacctacttgacccagat
gtggttgccaggttcaagcaacggtatcctgatggcattatctccaaacctaagaacatg
tag

DBGET integrated database retrieval system