KEGG   Phascolarctos cinereus (koala): 110220703
Entry
110220703         CDS       T05867                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110220703 (AKAP5)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110220703 (AKAP5)
SSDB
Motif
Pfam: WSK Calici_coat
Other DBs
NCBI-GeneID: 110220703
NCBI-ProteinID: XP_020860501
Position
Unknown
AA seq 448 aa
MESTVAEIQVESKDEKESIEISPQHEEQVEKASMICFKRRKKSAKALKSKNCSEKALRHT
GPCGAKDPTEVEASDQFQSPGGTWAAIRRLVTRRKRSKSSKKEVPLDAKAQPTENTYDTK
LAKKTARSRIKIPCIKLSRSKKKCSHSQIIEESECNMKVKEVTDSLGTEIQSPQDAPAVK
DKLIADVSGGSSQADSVSVPQVSHISSSGENVASIELGVDTESCAIQTAALILEKGIEET
EEKQVVNLHRGSLPEISEMGHQLPKENTEVGSVVAPNETPTEAPATPETQITEETLKDVT
EQKPKEKEHEDGVTASEKNKSKDTILCFRKSAFEENTGGPKMPPLEESRRMEPIAIIVTD
TEVSEFDVKKSKNVPKKFFISVENQQSEPFSNAVSSKGVNGFEGRTSEQYEKLLIETASS
LVKNAIQLSIEQLVNEMDSDDNKRNNLI
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggaatcaacggtggcggaaattcaggtagaaagcaaggatgagaaggagtctatagag
ataagtcctcagcatgaggagcaggttgaaaaagcatccatgatttgttttaaaagaaga
aagaaatcagccaaagctttgaagtcaaagaattgttccgaaaaagcactccgtcacact
ggtccgtgtggcgccaaggatcccacagaagtggaagcttcagatcagtttcagtcacca
ggggggacatgggcagcaatcagacgcttggtcactcgtcggaaaaggtcaaaatcttca
aagaaagaagtccccttagatgctaaagcacaacctacagaaaacacttatgacaccaaa
cttgctaagaaaacggctcgatccaggattaaaatcccctgcataaaactctcgagaagc
aagaaaaaatgcagccattcccaaattattgaagaatctgaatgcaatatgaaagtaaag
gaagttacagacagtttaggtacagagattcagagtcctcaggatgctccagctgtaaag
gataaattaattgcagacgtaagtggtggtagctcccaggcagatagtgtaagcgtgcca
caagttagtcacatcagctcttctggggagaacgtggcttccatagaacttggcgttgat
acagaatcttgtgccattcaaacagcagcgttaatccttgaaaaaggtattgaggagaca
gaagagaaacaggttgtaaacctccatcgaggaagcctccctgagatttcagaaatggga
caccagctacctaaggagaatacggaggttggtagcgttgtggcacccaatgaaaccccc
actgaggcacctgcaaccccagagacacagatcacagaagaaacattgaaggatgtcaca
gaacagaagccaaaagagaaagaacatgaagatggagtgactgcttcagaaaagaacaag
tcaaaagacaccatattgtgcttcaggaaatccgcttttgaagaaaatacaggaggtccg
aagatgcccccattagaagaaagcagaaggatggaaccgattgctattattgtcacagac
actgaagtcagcgaatttgacgtaaagaaatccaaaaatgtccctaagaaattcttcata
tcggtggaaaatcagcaaagtgagccattttctaatgctgtgtcatccaaaggggttaat
ggttttgagggcagaacttctgaacagtatgagaagcttttaatagaaactgcttcctcg
cttgtcaagaatgccattcagttgtctatagaacaactggtgaatgaaatggattctgat
gataacaaaagaaacaatcttatataa

DBGET integrated database retrieval system