KEGG   Phascolarctos cinereus (koala): 110221515Help
Entry
110221515         CDS       T05867                                 

Gene name
PUDP
Definition
(RefSeq) pseudouridine-5'-phosphatase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110221515 (PUDP)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     110221515 (PUDP)
Protein phosphatases and associated proteins [BR:pcw01009]
 HAD phosphatases
  Other HAD phosphatases
   110221515 (PUDP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 NiFe_hyd_3_EhaA
Motif
Other DBs
NCBI-GeneID: 110221515
NCBI-ProteinID: XP_020861869
Position
Unknown
AA seq 237 aa AA seqDB search
MASRAPGLASAPPLRPVTHLLFDMDGLLLDTERLYSVIFQEICDCFGKKYTWDVKAMVMG
KKALDAAQVIVEVLDLPLTKEELLTESKKKQEQIFPTASFMPGVEKLINHLYRHNIPIAV
ATSSAGLSFEQKTRRHKEFFSLFSHLVLGDDPEVKNGKPEPDLFLTCAKRFSPSPPAEKC
LVFEDAPNGVEAALAAGMQVVMVPDEQLNPELTRKATLVLKSLEDFKPELFGLPPYD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgcgagctcccggcctggcttctgcgcctccgctgcggccggtcacccacctg
ctctttgacatggacggcctccttctggatactgagcgactctattcagtgatattccag
gaaatctgtgactgctttggaaagaaatatacatgggatgtgaaagccatggttatgggt
aaaaaagcgttggatgcagctcaggttattgtagaagtcttggatcttccattaaccaaa
gaggaacttttgacagaaagcaaaaagaagcaagaacaaatatttccaacagcttcattt
atgccaggtgttgaaaagctgatcaaccatctatatagacacaacatacctattgctgtt
gctactagctctgctggattgtcatttgaacagaaaacaagaagacacaaagaattcttt
agtttgtttagtcatctcgttctgggagatgaccctgaggtgaagaatggcaaacctgag
cctgatttgtttctaacttgtgcaaagagattttccccttctcctccagcagaaaagtgc
cttgtgtttgaagatgctccaaatggagttgaagcagcccttgcagctgggatgcaggtg
gttatggttccagatgaacaattaaaccccgagcttacaagaaaggcaactttggtgctg
aaatcactggaggactttaagccagaattgtttggtttgccaccatatgattga

DBGET integrated database retrieval system