KEGG   Phascolarctos cinereus (koala): 110222359Help
Entry
110222359         CDS       T05867                                 

Definition
(RefSeq) 5'-nucleotidase-like
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00230  Purine metabolism
pcw00240  Pyrimidine metabolism
pcw00760  Nicotinate and nicotinamide metabolism
pcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110222359
   00240 Pyrimidine metabolism
    110222359
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    110222359
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     110222359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 110222359
NCBI-ProteinID: XP_020862956
Position
Unknown
AA seq 582 aa AA seqDB search
MEAADSAPASGPPPPEPEVDLSPLASGVLCMENGPCDLTILHFNDVYDVDPRVEEPVGGA
ARFATAVKKFSFLNPLLIFSGDCLNPSVLSTITKGKHMIPVLNELGVQFAVFGNHEFDFG
VDILEEYKRQMHFPWLLSNVYDKFTSEPLGHGTVKKIVNWNNITIGLMGLVEEDWLDTLA
TVSKSNLNYKDYVEVANQISVELKEEGADLIIAITHMKWINDTRLAQKAQGIDLILGGHD
HEYGIKKVNDTWIVKSGSDFRNLTKINIRRFGASFQYIFEKLDILNHLEEDPHIKAIVKD
YTQNLQYMLKEVLCPIDMELDGRAITVRRSESNLGNLITNAMLEATHADVALLNSGTLRS
DRIHPAGDFTLHDLLAILPIVDPVLVVRVTGAQLLEALENGVYKYPDLDGRFPQVAGMEF
GFDPDEEPGHRIIRDTVKIQGQYLRKKKVYLLAIKEYIANGKDGYIMLKSCPRMFDTETA
QTLSTVVLNHFESVKIVQGRKQCLSGHRMNLITMSKTASFTVFEEKSDKRTTVMAVPGIE
GRICHISQEMKEHLRQLRIARKEGLRTYPTINDNTCENSDSD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggctgactcggcccctgcgtctggccctcctcccccggagccggaggtggac
ctctcaccattagcctcgggggtcctgtgcatggagaacggcccctgcgacctcaccatc
ctccattttaacgatgtttacgacgtggacccgagggtcgaggagcccgtgggaggggcc
gccagatttgcaacagctgtgaaaaagttcagtttcctgaatccacttctgatttttagt
ggagactgcttaaatccttcagtattaagtactataacaaaaggaaaacacatgattcct
gttttaaatgaattaggagtacagtttgcagtctttggaaaccatgaatttgattttggt
gtggatattttggaagaatataagagacaaatgcatttcccatggcttctcagcaatgta
tatgacaaatttacttcagaacctcttggacatggcacagttaaaaaaatagttaattgg
aacaatataacaattggcttaatgggactagtggaagaagactggctagatacattagcc
acagttagcaaatcaaatctaaactataaagattatgttgaagttgctaatcaaatatct
gttgaacttaaagaagagggagcagatcttatcattgcaattacacacatgaaatggata
aatgatacccgacttgcccaaaaagctcaaggaatagatcttattctagggggccatgac
catgaatatggaatcaagaaagttaatgacacatggattgtgaaaagtggatctgatttt
aggaacttgacaaagataaatataagacgctttggggcatcttttcaatatatatttgaa
aaattggacattttgaatcatttggaagaagatccgcatattaaagcaatagtaaaagat
tatacccaaaacctacagtatatgttaaaagaagttctctgtccaattgacatggaatta
gatggacgtgcaattactgtaagaagatcagagagcaacctgggaaatctaataactaat
gcaatgttggaagctactcatgctgatgtagcactacttaattcaggtactcttcgttct
gatcgaatacatccagcaggggatttcactttgcatgatcttttggctattcttcccata
gtggacccagttctagttgtcagagtaacaggtgcacagctgcttgaagcacttgaaaat
ggggtttacaaatacccagatcttgatgggagatttcctcaggttgcaggaatggaattt
ggatttgatccagatgaagagccgggacacagaattatacgagatactgtaaaaattcaa
ggacagtacttaaggaaaaaaaaagtttatcttcttgctattaaggagtacattgccaat
gggaaggatggttatataatgcttaaaagttgtcctcgaatgtttgatacagaaactgca
cagacgctttctacagtggttctgaatcactttgaatcagtcaaaattgtgcagggtagg
aaacagtgcctttcaggccatcgaatgaacttaattactatgtctaaaacggcatcattt
acagtctttgaagaaaaatcagataaaagaacaacagtaatggcagtacctggtatagaa
ggaaggatttgccatatttctcaggagatgaaagaacatttacggcaacttagaattgca
agaaaagaaggattaagaacatatcccacaattaatgacaatacatgtgaaaattctgat
tctgactga

DBGET integrated database retrieval system