KEGG   Phascolarctos cinereus (koala): 110222982Help
Entry
110222982         CDS       T05867                                 

Gene name
METTL14
Definition
(RefSeq) LOW QUALITY PROTEIN: N6-adenosine-methyltransferase subunit METTL14
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcw03019]
    110222982 (METTL14)
Enzymes [BR:pcw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     110222982 (METTL14)
Messenger RNA biogenesis [BR:pcw03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     110222982 (METTL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Ofd1_CTDD
Motif
Other DBs
NCBI-GeneID: 110222982
NCBI-ProteinID: XP_020863964
Position
Unknown
AA seq 459 aa AA seqDB search
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAP
NAKRRYLDEGEADEEDMEEYKDEVELQPDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYC
QHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELISKSNTPPMYLQADLDAFDIR
ELKSKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIEELSGLRSFVFLWCGSGEG
LDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPXAVFQRTKEHCLMGIKGTVRRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTV
GPNLTNSNFNAETYASYFSIPNSPLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGERGRERNRSTFRGERGGFRGGRGGAHRGGFPPR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacagccgcctccaagagatccgcgagcggcagaagctgcgccggcaactcctcgct
cagcagttgggagctgagagtgcggacagtatcggtgccgtgttaaatagcaaagacgag
caaagggagattgctgagaccagagaaacttgcagggcttcttatgacacttcagctcca
aatgcaaagcgcagatatttggatgaaggggaggcagatgaagaagacatggaagaatat
aaggatgaagtagaattgcagccagatgaagagaacctgccctacgaggaagagatctac
aaagactccagtactttccttaaggggacccagagcttaaatcctcacaatgattattgc
caacactttgttgacacaggacacaggcctcagaatttcatcagagatgtgggtttagca
gatagatttgaagagtatcctaagctgagggagcttatcagactgaaggatgagctgatc
tcaaagtcaaacactcctcccatgtatttacaggcagatctagatgcttttgacatcaga
gagctaaagtccaaattcgatgtaattcttctggaacctcctttggaagagtattaccga
gaaactggaatcactgctaatgaaaaatgctggacctgggatgatattatgaagctagaa
attgaggagctttccggactacggtcatttgtctttttatggtgtggctctggggagggc
ctggaccttggcagagtgtgtttacgcaaatggggttacagaagatgtgaagatatttgc
tggattaaaaccaacaagaacaatcccgggaagacgaagactttggacccanaggctgtc
ttccagaggacaaaggaacattgtctgatgggcatcaaagggactgttcggcgtagcaca
gatggcgacttcattcatgccaacgtggacattgacttaattatcacagaagaacctgaa
attggaaacatagagaaaccggtagagatttttcatatcattgaacatttttgccttggt
agaagacgtcttcacctttttggaagggacagtacaatccgaccaggctggcttactgtg
ggacccaatcttaccaatagcaacttcaatgcagaaacttatgcttcctacttcagcatt
cccaattcccctctgacgggatgtacggaagagatcgagagactgcggccaaagtcaccc
cccccaaaatcaaaatctgatcgaggaggtggcgccccgagggggggcggcagagggggc
acgtctgccggtcgtggagagagaggccgggaaagaaaccggtccaccttccgcggagag
aggggcgggtttcgagggggccgtggaggggcccaccgcgggggcttccccccgcgctag

DBGET integrated database retrieval system