KEGG   Phascolarctos cinereus (koala): 110223414Help
Entry
110223414         CDS       T05867                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00071  Fatty acid degradation
pcw01212  Fatty acid metabolism
pcw03320  PPAR signaling pathway
pcw04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110223414
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110223414
  09159 Environmental adaptation
   04714 Thermogenesis
    110223414
Enzymes [BR:pcw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110223414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 110223414
NCBI-ProteinID: XP_020864592
Position
Unknown
AA seq 681 aa AA seqDB search
MLWLKGPGARCWLPRQPPGGGWRAWSLARAGAGAGAARDYWRSADHGLVSSTWDLDHHFV
HRSIIPTLHFQQSLPRLPVPELEDSIRRYMAAQKPLLGDSEYRKTEKLAKAFKNGIGKEL
HKNLIELDKKNFHTSYITGPWLDTYLSSRDPIVLNFNPFITFKRDPQESYNDQLVRATNL
TVSAIKFLNSLRSRILEPDIYYVNPQWSKSKAFKRFLSFLPTSVSWYGAYFAEAYPLDMS
QYVHLFNSCRVPKQGKDELFSDHGARHLLVMRNGHFYVFDILDPIGNILHPYEIQAHLIN
ILQDEETVAEYPLGYLTTENRNTWAAVREQLLQAGNEESVYKIDSAIFCLCLDSFRVENS
SHLSHCMLHGYGYNRWFDKSFSLIITVDGSAGINFEHSWGDGVAVLRFVNEVYADSTKHP
AVVPRGTAATLCSTNVEKLQFHLNASIQSAVTVARQKFDKQRHKMTVKPFEFRKFGKQYV
IQERMSPDAIFQLACQVAAYRQFGKIVPTYESCSTAGFKHGRTETIRSATVYTKRCAQAF
IRDRKKYSAQELRKLIESCSKYHKFLQMEAALGQGFDRHLFALRYLAESRGDPVPEFYRD
PAYQYINYNILSTSTLSSSSVFLGGFGPVVPDGFGIGYNIYDYWLGCNITSYMERDLDEF
LLDLEGSLNDFFDVFQGRSLK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggttgaaaggcccgggggcgcgctgctggctgccccggcagcccccggggggc
gggtggagggcgtggtcgctggccagggcaggggccggggcgggcgcggcgcgtgactac
tggcgctcggccgatcacgggctcgtgtcctccacctgggacctggaccatcacttcgtg
caccgcagcatcatccccaccctgcacttccagcagagcctgcccagattaccagttcca
gagttggaggattccatcaggcgatacatggctgctcagaaacctctactgggagacagt
gaatacagaaaaactgaaaaacttgcaaaggcttttaaaaatggaattggaaaagagtta
cacaaaaatctcattgagcttgataaaaagaattttcatacaagctacataacaggtcca
tggcttgatacgtatctttcttcaagagaccctattgttttaaactttaatcctttcatt
acatttaaacgagatccacaagaatcatataatgaccaactcgtgagagcaacaaatctg
actgtatcagcaataaaatttcttaactctctgaggagtcgtatcttagagccagacatt
tattatgtcaacccccagtggagcaagagtaaggcctttaaaaggtttctcagctttctc
ccaacttcagtgtcttggtatggagcttattttgcagaagcttatcctttagatatgtca
cagtatgttcacctctttaacagttgcagagttcctaaacaaggtaaagatgaactattt
tcggatcatggtgcacgccatttgctggtgatgagaaatggacatttttatgtatttgac
atattggatcctattggaaatattctacatccgtatgaaatacaagcacatttaattaat
attttacaggatgaggaaacagtagctgagtatcctctgggctacctcaccactgagaac
agaaatacctgggcagcagtcagagaacagcttctgcaagctgggaatgaagagagcgtg
tacaagattgatagcgcaatattctgcttgtgtttagatagttttagagtagaaaacagt
tcccacctatcacactgtatgcttcatggatatggttataaccgctggtttgacaaatct
ttcagtttaattatcactgttgatgggagtgcagggataaattttgaacattcttgggga
gatggagttgcagttctccgttttgttaatgaagtatatgcagatagcacaaagcatcct
gcagtagttccaagagggacggctgctacgctatgttctacaaacgtggaaaagctgcaa
tttcatttgaatgcatcaattcagtcagctgtgactgttgcacgtcaaaaatttgacaag
caaagacataaaatgacagtgaaaccatttgagtttagaaagtttgggaaacagtacgta
attcaagaaagaatgagtccagatgctatatttcaacttgcatgtcaggtggctgcttat
cgtcagtttgggaaaattgttcctacatacgaatcatgtagtactgctggctttaaacat
ggtcgaacagaaactattcgatctgcaacagtttacacaaaacgatgtgctcaggcattt
atcagagaccggaaaaaatacagtgcgcaagagctaagaaagctaattgaaagctgttca
aaataccacaagtttttacagatggaagccgcactgggacaaggatttgatcgacattta
tttgcactgaggtatcttgcagaatccagaggtgaccctgtgcctgaattttaccgggac
ccagcctaccaatacattaactataacatcctttcaaccagtacattaagtagttcttca
gttttccttggtgggtttggaccagttgtaccggatggctttggaattggatataatatc
tatgactactggttagggtgtaacattacttcatatatggaaagagatttggatgagttt
ctattagatcttgaaggtagtttaaatgatttttttgatgtttttcaagggaggtcactt
aaataa

DBGET integrated database retrieval system