KEGG   Phascolarctos cinereus (koala): 110223488
Entry
110223488         CDS       T05867                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcw01002]
    110223488 (ERAP1)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110223488 (ERAP1)
Peptidases and inhibitors [BR:pcw01002]
 Metallo peptidases
  Family M1
   110223488 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N MarC
Other DBs
NCBI-GeneID: 110223488
NCBI-ProteinID: XP_020864713
Position
Unknown
AA seq 998 aa
MLQAGERPATTFQGLPSSLLLLLSLSVPTLRGLTCKGPGQRAPAPRNSGSMPIGNFRSKN
KMAILPLQLPLMTLPSLLTTLIVWASTRCQSMETNSPRAINGAPFPWNNMRLPNYIFPIH
YNLMIHANLTTLTFSGATEVEIIVNQPSSFIVMHSQRLQITKATLREKSQDNRVEQPLTV
LEYPSNHQIALIADQPLQIGRQYIVTIEYAAPLSESLHGFYKSSYRTQKGEVRMLASTQF
EPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVNIAEGLIEDHFDVTVKM
STYLVAFIISDFESVSKMTKSGVKVSVYAVPEKINQTGYALDAAVTLLEFYEDYFNISYP
LPKQDLAAIPDFESGAMENWGLTTYRESGLLYDVEKSSASSKLRITMMIAHELAHQWFGN
LVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFDAMEMDALNSSHPVSAP
VENPAEIQEMFDNVSYEKGACILNMLRDYLNADVFKAGIVQYLQKYSYKNTKNEDLWNSM
TNICLIGDTQKTDGFCSRNQPTSSPSHWSKEAVDVKAMMNTWTLQKGFPMITVTMRGKNV
HMKQELYRKGSSHSEETGYLWHVPLSYITSKSDKVERFLLRTKTDVLILPEEVEWIKFNV
GTYGYYIVHYEDDGWESLTGLLKEKHMTISSNDRASLINNAFQLVSIGKLSIEKALDLTL
YLKHETEIMPVFQGLNELIPLYKLMEKRDMDDVETQFKAFLIRLLRDLIDKQTWTDDGSV
SQRMLRSQLLLLACVRQYQPCVQKAEDYFKKWKESNGNFSLPCDVTSAVFAVGAQTTEGW
DFLFEKYQLSLSSTEKYKIEFALSTSHDKEKLQWLLEQSFQGDIIKTQEFPSILGLVGRN
PKGYLLAWQFLKENWNRIIQKFELGSNSLTDMVIGTTNQYSTRERLEEVKEFFSSLKENG
SQLRCIQQTLETIEENIHWMNQNYENIRVWLQKSTSSL
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgctccaggcaggggagaggccagctacaacctttcagggccttccctcctctctcttg
cttctactttcactttcagtccccacactaagaggcttaacctgcaaaggaccgggacag
cgggctccggcccccagaaactcagggtctatgccaataggcaattttaggagcaagaac
aagatggctattttgccacttcagttaccacttatgactttaccatcactgttgactacc
ttgattgtatgggcttctacaaggtgccaaagcatggaaacaaactctccaagagctatt
aatggagctccatttccttggaataatatgcggcttcccaactacatctttccaattcat
tataatcttatgatccatgccaatctcaccactttgacattctcgggagccactgaagta
gaaatcatcgtcaatcagcccagcagtttcatcgttatgcatagccaacgcctgcagatc
accaaggcaaccctcagagagaaaagccaagataatcgggtagagcagcccctgactgtt
ctggagtatccatccaatcaccaaattgcacttatagccgatcagccccttcagattgga
cgtcagtacatagttaccattgaatatgctgcccctctttctgaatctttgcatggattt
tataaaagttcttatagaactcagaagggagaagtgaggatgctagcatccacacagttt
gagccaacggcagcaaggatggcctttccctgcttcgatgaacctgcctttaaagctagt
ttctcaatcaagattagaagagaaccacggcaccttgctatctccaacatgccattagtg
aaatctgtgaatattgctgaaggactaatagaagaccactttgatgtcactgtcaagatg
agcacttaccttgttgcttttattatttcggattttgagtctgtcagcaagatgaccaaa
agtggagtcaaggtttctgtgtatgctgtaccagagaagataaaccaaacaggctatgcc
ctggatgctgcagtgacccttttggaattttatgaggattatttcaacatttcatatcct
ttacccaaacaagatcttgccgccatccctgactttgaatctggtgccatggaaaactgg
ggattgacaacgtacagagaatctggactgttgtatgatgttgaaaaatcctctgcttcc
agtaaacttcggatcaccatgatgatagcccatgaactagcccaccagtggtttgggaat
cttgtcaccatggaatggtggaatgatctttggctaaatgaagggtttgcaaagtttatg
gagtttgtgtctgtcagtgtgacccatccagagttgaaagttgaagattatttctttgga
aaatgttttgatgccatggagatggatgcattaaattcttctcatcctgtgtccgcacca
gtggagaatcctgctgagattcaggaaatgtttgataatgtttcttatgaaaagggagct
tgtatcttgaatatgctaagggactatcttaatgcagatgtattcaaagctggcattgtg
caatatctccagaaatacagttataagaacaccaaaaatgaggatctgtggaatagtatg
acaaatatttgtctgataggtgacacacaaaaaacagatggattttgctcaaggaaccaa
cctacatcctcaccttcgcactggagcaaggaggctgttgatgtaaaagccatgatgaac
acgtggacactacagaaggggtttccaatgatcactgtcaccatgagaggaaagaatgtc
catatgaagcaagaactctataggaagggaagcagtcactctgaggaaactgggtacctg
tggcatgttccactgtcatacattaccagcaaatcagataaagttgaaagatttttgcta
agaacaaaaacagatgtcctcatcctcccagaagaggtagaatggatcaaattcaatgtg
ggaacgtatggctattacattgtacattatgaggatgatggatgggaatctttgactggc
cttttaaaggaaaagcatatgacaatcagcagcaatgatcgggctagtctaattaacaat
gcatttcagcttgtcagcattggaaaattatccattgaaaaagctttggacttaaccctg
tacctgaaacatgagactgaaattatgcccgtgttccaaggtttgaatgagctgattcct
ttgtataagttaatggagaaaagagatatggatgatgtagaaactcaatttaaggctttc
ctcatcaggttactcagggacctcattgataagcagacatggacagatgatggctcagtc
tcacagagaatgctgcgcagtcaactccttctgcttgcttgtgtacgccagtatcaacct
tgtgttcagaaggcagaagactatttcaagaaatggaaagaatccaatggaaattttagc
ttaccatgtgatgtgacctcagcagtgtttgctgttggggcacagaccacagaaggctgg
gattttctctttgagaaatatcagttgtctttgtccagtactgagaaatacaaaattgaa
tttgccctgtctactagccatgataaagaaaagcttcaatggttgctggagcagagtttt
cagggggatataataaaaactcaagagtttccaagtattcttggtttggttggcagaaac
ccaaagggttatctcttggcttggcaatttctgaaggaaaattggaatagaatcatacag
aagtttgaacttggctcaaattctctaacagacatggtgataggaaccacaaatcagtac
tctacaagagaacgacttgaagaggtgaaagaattctttagctctttgaaggaaaatggt
tcccagcttcgctgtatccaacaaacacttgaaacaattgaagaaaacatacattggatg
aatcagaattatgagaacatcagagtgtggttacaaaaaagcaccagctcattgtaa

DBGET integrated database retrieval system