KEGG   Phascolarctos cinereus (koala): 110223640Help
Entry
110223640         CDS       T05867                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00564  Glycerophospholipid metabolism
pcw00565  Ether lipid metabolism
pcw00590  Arachidonic acid metabolism
pcw00591  Linoleic acid metabolism
pcw00592  alpha-Linolenic acid metabolism
pcw01100  Metabolic pathways
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04217  Necroptosis
pcw04270  Vascular smooth muscle contraction
pcw04370  VEGF signaling pathway
pcw04611  Platelet activation
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04724  Glutamatergic synapse
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04912  GnRH signaling pathway
pcw04913  Ovarian steroidogenesis
pcw04921  Oxytocin signaling pathway
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110223640 (PLA2G4D)
   00565 Ether lipid metabolism
    110223640 (PLA2G4D)
   00590 Arachidonic acid metabolism
    110223640 (PLA2G4D)
   00591 Linoleic acid metabolism
    110223640 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    110223640 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110223640 (PLA2G4D)
   04010 MAPK signaling pathway
    110223640 (PLA2G4D)
   04370 VEGF signaling pathway
    110223640 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    110223640 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110223640 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110223640 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    110223640 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    110223640 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110223640 (PLA2G4D)
   04913 Ovarian steroidogenesis
    110223640 (PLA2G4D)
   04921 Oxytocin signaling pathway
    110223640 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110223640 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    110223640 (PLA2G4D)
   04726 Serotonergic synapse
    110223640 (PLA2G4D)
   04730 Long-term depression
    110223640 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110223640 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110223640 (PLA2G4D)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110223640 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 Patatin
Motif
Other DBs
NCBI-GeneID: 110223640
NCBI-ProteinID: XP_020864932
Position
Unknown
AA seq 823 aa AA seqDB search
MESLVSEELSCHTHQVTVPRELMDRPRGEAFPCCQLSVKILEARNLFQTDLLSEADPYVV
LKLPTASGTTFKTKIVSNSNHPIWNETFSFRIQKQVKNILELKVYDADLATEDDALFTVF
FDTIEVSPGKPIQKTFSLNPQGQEELDVEFQVAEISDSPENLITNNVLVSRELSCLTVQV
DKTGSTAAVTDEDELELTLKGSCEDTQISALGSGMADSFLFHYITAQETEMRGCLKRLAA
GGESESSPAENLTVPLRYLPRGEEVAVTVPAPDATALKLKLRANSCSEKLAVRLGFGLCD
EEQTFLKKRKQVVAKALKRVLRLARELQEDEVPVIGVMAIGGGARAMTSLYGHLSALKKL
DLLDCVTYISGTSGSTWTLASLYADPEWSQQDLEKPIHHAREHMTKSKLGAFSLGRMKGY
QQELRQRAREGRPPSFVDLWALVLEFLLHGKVTEQKLSEQRASLEQGQNPLPLYLGLNVK
ENNLGTLDFKEWVEFSPYEIGFLKYGAFIPSELFGSEFFMGRLMKKLPESRICFLEGLWS
NIFSVNLMDAWYDLTSSEETWKQHIRDKTRNIEKEPPGSRRTSWIEMSWLQPKTALTQAL
RGLLTGRPLHHQCHNFLRGLHLHQDYCGQRNFRIWGDRQLDSDPSQLTTLQPQLCLVDAA
YFINTSCPLLLRAGRSPDLILSFGYSLNSPFETLEQMETYCRGQGIPFPRVELSQEERLQ
PRECHVFSDPDCPEAPTVLHFPLVNLSFREHSAPGVKRSPEELERGHVDLTGFLSPYSLA
NVTYSGDDFDRLLCLSAYNVQNNQGEILRALRTALKHRKQRQP
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctggtgtctgaggaactgtcctgccatactcaccaggtaacagtgcctcgt
gagctcatggacagacccaggggggaagcctttccctgctgccagctctctgtgaagatc
ctggaagccagaaacttgttccagacggacctgctaagtgaggctgacccgtatgtcgtc
ctgaagctgccaacagcatcaggcaccacatttaagaccaaaattgtctccaattcgaat
caccccatttggaatgagaccttcagcttccggatccagaagcaagtcaagaatatccta
gaactgaaggtctatgatgcagacttagccacggaagatgatgccctcttcactgtcttt
tttgataccattgaagtcagccctggcaaacccatccaaaagactttctctctgaatccc
cagggacaggaggagctggatgtggagttccaggtagcggaaatatcggattctccagaa
aacctcatcaccaacaatgtccttgtgagccgggagctatcctgtctgacagtacaggtg
gacaagacggggagcacggcagcagtcacagatgaggatgagctagagctgacattgaag
ggatcctgtgaagacactcagatctctgctctgggctctggtatggctgactccttcctc
ttccactatataacagctcaagagacagagatgaggggttgcttgaagaggcttgcggct
ggtggagagagtgagagcagccctgccgagaatctcactgtgcccctgaggtacctgcct
cggggggaggaggtggcagtcaccgttccggccccagatgccacagcattgaagttgaag
ctcagggccaattcttgctctgagaagctggctgtccgcctgggcttcgggctgtgtgat
gaggagcaaacattcctgaagaagaggaagcaggtggtggccaaggccctgaaacgggtt
ctgcggctggcgcgtgagctgcaggaagatgaggttccagtcattggggtcatggccatc
ggtggaggggctcgggcaatgacgtctttgtatggccatctctctgccctcaagaaactg
gacctcctggactgtgtaacctacataagtggcacttcaggatctacctggactttagct
agcttgtacgcagatcctgagtggtcacagcaggacctggagaagcccatccaccatgcc
cgagagcacatgacgaagagcaagctgggagccttctctctggggcgcatgaaagggtac
cagcaggagctgagacagcgggccagagaggggcgtcccccttcctttgtcgacctgtgg
gccctagtcctggagttcctcttacatggcaaggtaacagaacagaaattgtcagagcag
agggcttcactggagcagggccagaatccgcttccactataccttggtctaaacgtcaaa
gaaaacaaccttggaaccctggacttcaaagaatgggtggagttctccccctatgagatt
ggtttcctgaagtatggggccttcatcccctctgagctctttggttctgagttctttatg
ggacggttgatgaagaagctcccagagtccaggatctgcttcctagaaggcctatggagt
aatatcttctctgtgaatctgatggatgcttggtatgatctcaccagctcagaagagacc
tggaagcagcatatccgggacaagaccagaaacattgaaaaggaaccccctggctcccgg
aggacctcctggattgaaatgtcatggctgcagcccaaaactgctctcacccaggctctt
cggggcctcttgactgggcggcctcttcatcaccaatgtcataatttcctgagaggcctt
catctgcaccaggattactgtggccagagaaatttccgcatctggggtgaccgccagcta
gattctgaccccagccaactgaccactctgcaaccccagctctgcctggtagatgccgcc
tacttcatcaacacaagttgcccactcttgttgcgggcaggccggagtccagacctcatc
ctctcatttggctattccctcaactctccctttgagacgctggagcagatggagacgtac
tgccgagggcagggcatccctttccccagagtggagctgagtcaggaggaacgcctgcag
cctagggagtgccacgtcttctctgaccctgactgccccgaagcccccactgtgctgcat
ttccccttggtcaacctttccttcagagagcactcagcccctggtgtcaagcgcagccct
gaagagcttgagagaggccacgttgacctcacaggcttcctgtctccatattccctggcc
aacgtgacatacagtggggatgattttgaccgactgctctgcctcagtgcctacaatgtg
cagaacaaccagggtgagatcctaagggctctgaggactgcgctgaagcatcgcaaacag
cgccagccttga

DBGET integrated database retrieval system