KEGG   Paenibacillus crassostreae: LPB68_06625Help
Entry
LPB68_06625       CDS       T05196                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pcx  Paenibacillus crassostreae
Brite
KEGG Orthology (KO) [BR:pcx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pcx03009]
    LPB68_06625
Enzymes [BR:pcx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LPB68_06625
Ribosome biogenesis [BR:pcx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LPB68_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOZ91925
UniProt: A0A167EE28
Position
complement(1372242..1373150)
Genome map
AA seq 302 aa AA seqDB search
MSYQGSWSRRGEWLELIPGKVIRESDDRETATMTWLLNVVGMPEKLLRRLKHEKGIQWNG
DKLRLAIFPSRPIGINSIWQELKVLYEDDFCLVIHKPAGMMIHPDGRAGEVTLDHIVAAH
FESMGDNVAVRHIHRLDQHTSGPVLYAKNEWAQLNLDEDMRAKQIERKYVAFVEGKVDSS
LTVIDLPIGKDRHHAQRRRVSPTGQSAITHVRVEERYKGSSLIKLELDTGRTHQIRVHLS
HLGHPLLGDTLYGGSSSHIRRQALHGEQLCFSHPFTGDFIEINDDWPKDMVDLRLLLRAE
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagttaccaaggtagttggagtcgtagaggtgaatggctggagcttattcctggcaaa
gtgattcgtgaatcagacgaccgtgagactgctacaatgacttggctattgaacgttgta
ggtatgcctgaaaagctattgcgtcgactcaaacatgagaagggaattcaatggaatgga
gataagttgagattagctatatttccatcccgacctatagggataaactcgatatggcag
gagttaaaagtactctatgaggatgatttctgcttagttattcataaaccagcagggatg
atgattcatccggatggtcgtgctggtgaagtgacattagatcatatcgttgctgctcac
tttgagagtatgggtgataatgtagcggtaagacatattcatcgacttgatcagcatacg
tcaggacctgtgctctatgctaaaaatgagtgggcacagttgaatctagatgaagatatg
cgtgcgaaacaaattgagcggaaatatgtcgcttttgttgaaggtaaagttgattcgagt
ctaactgtgattgacctaccaattggcaaggatcgtcatcatgctcagaggcggagagta
tctcccacaggtcaatctgcgatcacacatgtgcgtgtggaagaaagatacaaagggtca
agtcttattaaacttgaattggatacaggtcgtacgcatcaaatacgtgttcatttaagc
catttaggacatcctttattgggtgatacattatatggtggtagtagttctcatattcga
cggcaagcgttacacggagaacagttatgtttctctcatccatttactggtgattttatt
gaaattaatgatgactggcctaaggatatggttgatcttcggttacttctacgagcagaa
gtcaaatga

DBGET integrated database retrieval system