KEGG   Paenibacillus crassostreae: LPB68_14835Help
Entry
LPB68_14835       CDS       T05196                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pcx  Paenibacillus crassostreae
Pathway
pcx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pcx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LPB68_14835
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pcx03011]
    LPB68_14835
Ribosome [BR:pcx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LPB68_14835
  Bacteria
    LPB68_14835
  Archaea
    LPB68_14835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOZ93363
UniProt: A0A167E773
Position
3256590..3256922
Genome map
AA seq 110 aa AA seqDB search
MEAKAHAKSIRISSRKVQLVIDLIRGKEVGAAIAILRHTPKAASPVVEKLLNSAIANAEH
NYSLDVNKLFVSEVYVNQGPTMKRFRPRAMGRASKINKRTSHISLVVSEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcacatgctaaatctattcggatttcttcccgtaaagttcaattagta
attgacttgattcgtggaaaagaagttggcgctgcaatcgcaattcttcgccacactccg
aaagccgcttccccggttgtggaaaagttgttgaactcagcgatcgcaaatgctgaacac
aactattcactagatgttaacaagttgtttgttagtgaagtttatgtcaaccaaggaccg
acgatgaaacgtttccgtcctcgtgcgatgggacgcgctagcaagatcaataagcgtact
agccacatttctttggtggtatctgagaaataa

DBGET integrated database retrieval system