KEGG   Plasmodium cynomolgi: PCYB_071440Help
Entry
PCYB_071440       CDS       T02490                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pcy  Plasmodium cynomolgi
Pathway
pcy00220  Arginine biosynthesis
pcy00330  Arginine and proline metabolism
pcy01100  Metabolic pathways
pcy01110  Biosynthesis of secondary metabolites
pcy01130  Biosynthesis of antibiotics
pcy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcy00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PCYB_071440
   00330 Arginine and proline metabolism
    PCYB_071440
Enzymes [BR:pcy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PCYB_071440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 14691990
NCBI-ProteinID: XP_004221589
UniProt: K6V918
Position
7
AA seq 434 aa AA seqDB search
MKQQTPTVSPSKMIECIENYLKTFKEKENMYVKKKVSIIGSPLSAGQPLGGVHLACDNLR
MLGLHKVIEALGWSYEDVGNIDTGGSGGSVSSSGSTVDKDIVWGRTDEQTEMNGTLNTHN
RSYAHTEKYHYGMEKMNGDTKLNHCCNGKDNANWENHSDINDHGGGGYMTKMCVQNNYYN
NIKNVEIIGKFGEKLFRTMSKELRKKNFVLNIGGDHSVAFPSILSSLQFYRDLRVIWIDA
HGDINIPETSPSGNYHGMALAHTIGLFKNKVPCFEWSENLTYLKPENVAIIGIRDIDMYE
KIILKKCNINYYTIFDIEKNGIYNTICTALNLLDPHENCPIHVSLDIDSVDSFFAPGTGT
IAKGGLNYREINLLMKVLADTRRIVSMDLVEYNPSLDENDKMVHSDSLPISEYATKTGKL
CLELIARVLGNDIV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagacaccaactgtatcccccagcaaaatgattgaatgtatcgagaattat
ttaaaaacgtttaaggagaaggaaaacatgtatgtgaaaaaaaaagtgtccataattggg
tcccccttgtcggcgggacagcccttgggaggagtgcacctggcttgtgacaatttaagg
atgctcggtttgcacaaggtgatagaggccttgggttggagttacgaagacgttggaaat
attgatactggtggaagtggaggaagtgttagcagcagtggaagtactgtagacaaggat
atcgtctgggggaggactgacgaacagaccgaaatgaacggaacgctaaacacgcacaac
aggagctatgcacacacggagaagtaccattacggaatggaaaaaatgaacggagacaca
aaattaaaccactgctgcaatggaaaagataatgccaattgggaaaatcatagtgacatt
aatgaccacggggggggaggatacatgaccaaaatgtgcgtacaaaataactactataat
aatataaaaaatgttgaaattattggaaaatttggtgaaaaattatttcgcacaatgagt
aaagaattgaggaagaaaaattttgtattaaacattggaggtgaccacagcgttgcattt
ccaagcattctgagctctttgcaattttaccgagatttaagagtcatatggatagatgcc
catggagacattaacatcccggagacctctccttcaggaaattatcatggcatggcatta
gctcacaccatagggctctttaaaaacaaagtgccatgcttcgaatggtctgaaaatctc
acatatttaaaaccagaaaatgtggctatcattggaatacgagatatcgatatgtatgaa
aaaattatcttaaaaaaatgtaacattaattattatacaatctttgacattgaaaaaaat
ggcatatacaataccatctgtacagctcttaacctgctagatccccatgaaaattgcccc
atacacgtttctctcgacatagatagtgtcgatagtttttttgccccaggaactggaacc
attgccaaggggggcctaaattatagagaaattaatttattaatgaaagtcctggcagac
acaaggcgcatcgtttcaatggatttagtagaatataacccatctctcgacgaaaatgat
aaaatggttcacagcgattccttacccatttctgagtatgccacaaaaacgggcaagctt
tgtctggagcttattgccagggttctcggcaacgacatcgtctag

DBGET integrated database retrieval system