KEGG   Plasmodium cynomolgi: PCYB_102950Help
Entry
PCYB_102950       CDS       T02490                                 

Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
pcy  Plasmodium cynomolgi
Pathway
pcy00270  Cysteine and methionine metabolism
pcy00480  Glutathione metabolism
pcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PCYB_102950
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PCYB_102950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcy04147]
    PCYB_102950
Enzymes [BR:pcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     PCYB_102950
Exosome [BR:pcy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCYB_102950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 14693305
NCBI-ProteinID: XP_004222892
UniProt: K6UWY3
Position
10
AA seq 670 aa AA seqDB search
MEGDDLESRVNHFYGVVQQEIINFFTEEKDNNKYLSYARIQLLMQDLMDYLNSDGFYIFT
KACQGGGNIRYLQEPKLFSFSVIPQMLSRSLLQLCQECTLLYSQLFDNIVCDMHFLLSVF
EGIKEYDDFCGRLIGICERVYLSKEGPGRDIKNDIRCVIGRSDYMLDSPGGGPQSGRSGE
SGESGEMGEMGRSGRSQPGGQNCQVKQIEYNTISVAFGNLSSVLFEAHKSMLKQVYRECF
PLEGEGQPLEKGLPQGEVRGGRPLKEVGSILEGKFKNDFLEGIVTCMKKCHEEYLTKTQP
LQGNNKTVILSILHNEDLNSFDKYRTKYELNKMDISQKCLTIKELQLFYEKKKLFLNYPH
ETLAETLKRVKECQKELHEGKLAPGKLLLDLNAREYDPYECPNYMEHVLEVSVVYFRSLY
SPDHFNETIWNVRELLEFSDAVKIPSVPYQLVGSKRIQMMLLDESILKKYLSLDLNKRKK
SDKQIQHDMNLLQKTFALQVDPSLSQNEHIVSHAIREDHHYLLKPQREGGKNNLHGTDIR
EKLMLYYKPEERDKLSFYVLMQRLFPTPFTAVHCRTRVHPSGEATCDSSNTEKGAVGGNI
SGVQCVSKSHIVEFSPEQSISEISLFHNFVFCKNVNLLNEQKGYLVRTKNARENEGGAIC
GISSLDSFFL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggagggagacgacctggagagcagagtgaaccacttctacggagtggtgcagcaggaa
atcataaactttttcacagaggagaaagacaataataagtacctcagttacgcacggata
caactgttaatgcaagatttgatggattatctaaatagtgatgggttctatatctttacc
aaagcgtgccaaggagggggcaacatcaggtacctccaagaacccaagctgttctcattt
tcagtgatcccacagatgctaagtcgaagtctcctacaactctgccaggagtgcacattg
ctttactcgcaattatttgacaatatcgtttgcgatatgcattttttattaagcgtgttt
gaagggataaaagagtacgacgatttttgtggtaggctgattgggatttgcgagagggtt
tatttgagtaaggagggcccagggagagacataaaaaacgacatacgttgcgttattggc
cggtcggactacatgctggacagccctgggggggggccacaaagcggaagaagcggagaa
agcggtgaaagcggcgagatgggagaaatgggacgaagcggacgaagccagccaggcgga
caaaactgccaagttaaacaaatcgagtacaacaccatttcggtggcatttggcaacctg
tcgtctgtgctgttcgaggcgcacaagagcatgctgaagcaggtttaccgggagtgcttc
cccctcgagggggaggggcaaccgctagagaaggggctaccgcagggggaagtgcgggga
ggacggcccctaaaggaggtgggctccatcctggaggggaaattcaaaaatgatttcctc
gaggggatagtcacgtgcatgaagaagtgccacgaggagtacctcaccaaaacacaaccc
ttgcaaggaaacaacaaaacagttatcctttccattctacacaatgaggatctaaacagt
ttcgataaatacagaaccaagtatgagttaaataaaatggacataagtcagaaatgccta
acgataaaggagttgcaacttttttatgaaaaaaaaaaattatttttaaattatcctcat
gagacgttagcagagacattaaaaagggtgaaggaatgtcaaaaggagctccacgagggg
aagcttgctcctggaaaactcctcctagatttgaatgctcgagagtatgacccatatgag
tgccccaattatatggagcacgtgttagaagtgagtgtggtgtacttccgatcactttac
tcacctgatcactttaatgagactatttggaacgtgagggagttactcgaattcagtgat
gctgttaagattccatcggtgccttaccaactagtgggatcgaaacgaatacaaatgatg
ctccttgatgaatccatcctaaaaaagtatctctctctagacttaaataagagaaaaaaa
tcagacaagcaaatacaacacgatatgaatctgttacagaaaacgttcgccctgcaggtg
gacccatcgctcagccaaaatgaacacatcgtttcgcatgccattagggaggaccaccat
tatttactcaaaccgcaaagagaggggggaaaaaataatttacacggtacagacattagg
gaaaagctcatgctttactataaaccggaggaacgggataagctctccttttatgtcctc
atgcagaggttgtttccgactccattcactgcggtgcattgcaggacgagggtgcaccca
agcggggaggccacatgtgattcttcgaatacagagaagggagcagtgggaggaaatata
tccggcgtccaatgcgtgagtaaatcccacatcgttgaattctcacctgaacaatccatc
tccgaaattagcctcttccacaattttgtgttttgcaaaaatgtgaacctgctgaatgaa
cagaaggggtacctggtgcgcacgaagaacgcccgggagaacgaggggggcgccatttgc
ggcatctccagcttggactccttcttcttg

DBGET integrated database retrieval system