KEGG   Plasmodium cynomolgi: PCYB_121800Help
Entry
PCYB_121800       CDS       T02490                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] mitochondrial precursor
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pcy  Plasmodium cynomolgi
Pathway
pcy00020  Citrate cycle (TCA cycle)
pcy00480  Glutathione metabolism
pcy01100  Metabolic pathways
pcy01110  Biosynthesis of secondary metabolites
pcy01130  Biosynthesis of antibiotics
pcy01200  Carbon metabolism
pcy01210  2-Oxocarboxylic acid metabolism
pcy01230  Biosynthesis of amino acids
pcy04146  Peroxisome
Module
pcy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCYB_121800
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PCYB_121800
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PCYB_121800
Enzymes [BR:pcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PCYB_121800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh Stathmin
Motif
Other DBs
NCBI-GeneID: 14693981
NCBI-ProteinID: XP_004223559
UniProt: K6VED2
Position
12
AA seq 422 aa AA seqDB search
MTKIIWKEIKEKLILPYLDLNIKYFDLSIENRDKTNDQVTLEAAEEIKKSSVGIKCATIT
PDAARVKEFNLKKMWKSPNGTIRNILDGTVFRAPILIKNIPRLIPNWKKPIIIGRHAYAD
QYKQKSLKIEKSGKFEIVFTPDDNSQVMREEIFHFKSPGVCLGMYNTEESITNFALSCFQ
YALDLKMPVYMSTKSTILKIYDGLFMEIFQKIYDQKFRTAFEQNNLWYEHKLIDDMVAQV
LKSEGGFVWACKNYDGDIQSDAVAQGYGSLGLMSSILMCPDGVTCVSEAAHGTVTRHYRC
HQRGEKTSTNPIASIFAWTRGLQHRAKLDNNQPLQLFCYALERACIETVEDGLMPKDLAA
CIKGLKNVTEKDYLFTDDFINAINEKLKLKLLANQAKNDAQAATTTKLQNENWNNYAPQE
HS
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaattatttggaaggaaatcaaagagaagctaatcctgccatacttggatctg
aatataaagtacttcgatctgtcaatcgaaaatcgagataaaaccaacgaccaagtgacg
ttagaagcagcagaagaaataaagaaatcatcggtaggaattaaatgtgcaacaattaca
ccagatgcagctagggttaaagaatttaacttaaaaaaaatgtggaaaagtccaaatgga
accataagaaacatattagacggtacagtattcagagcccccattttgataaaaaatatc
ccgaggttaattcccaattggaagaagccaatcatcataggaaggcatgcttatgcggat
cagtacaagcagaagtccttgaagattgaaaaaagtggaaaattcgaaattgtttttaca
ccagatgataactcccaagttatgagagaagaaattttccacttcaaatcaccaggggtt
tgtctaggaatgtacaacactgaagagtccatcacaaattttgctctttcgtgttttcag
tatgcactagatttaaagatgcctgtttatatgagtacgaaaagtactatactcaaaata
tacgatgggctatttatggaaattttccaaaaaatttatgaccaaaaatttcgcacagca
tttgagcagaacaacttatggtatgaacacaagctgatcgatgacatggttgctcaagta
ctcaaatcagaagggggatttgtatgggcttgtaaaaattacgatggagatatccaatcc
gatgcagttgcacaaggttatgggagcttaggtctaatgagctccattctaatgtgccca
gatggagtaacgtgtgtgtcagaagcagcacatggaacagttacacgacattatcgttgt
catcaaagaggagaaaaaacatctaccaaccctattgcttctatctttgcctggaccagg
ggattacaacatagagccaaattagataacaaccagcctcttcaattattctgttatgct
ctcgaaagggcttgcatagaaactgtagaggatggactaatgccaaaggaccttgctgcc
tgcataaagggacttaaaaatgtcacagagaaggactacctcttcacggatgatttcatt
aatgccattaatgagaaactgaaattgaagctgctcgcaaatcaggcgaaaaatgacgcc
caggcagccaccaccaccaagctgcaaaacgagaactggaacaattatgccccgcaggag
cattcg

DBGET integrated database retrieval system