KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_27090Help
Entry
PCL1606_27090     CDS       T03768                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PCL1606_27090
Enzymes [BR:pcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PCL1606_27090
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PCL1606_27090
    1.1.1.-  
     PCL1606_27090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AKA24160
UniProt: A0A0D5XZE9
Position
complement(2912334..2913398)
Genome map
AA seq 354 aa AA seqDB search
MKALRWHAARDLRLTDLSLPEPGPGQVLVQVAYCGICGSDLHEYADGPHSIPQQQPHPLS
GCRAPLTLGHEFCGQVLAVGPGVEQVRVGSRVAVEPEYRCGDCQYCHAGQYNLCQSMGFI
GLMGDGGFAEQVLVPAYMLHPLPDSVSFKQAAVLEPAAVAFHALNQSRLMAGDSCVVFGL
GPIGLLLILLARLRGVERIFAVDLSPERRRLALDFGAREVLDGRAADLSQRLQELSGGGL
DTAFEAAGSQQTLDLALHSLRKGGEVVLVGLMGEVGFDAFHLVNRELRLLGSVGYRNAYP
PLIELLASGRLDLTRAVTRCVTLEQAVEHGFEALLRDKGQIKVLVNPNPSLAKA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgttggcatgccgcccgcgacctgcgcctcaccgacctctcgctgccc
gaacccggcccgggccaggtgctggtgcaggtggcctactgcggcatctgcggcagcgac
ctgcacgaatacgccgacggcccgcactcgattccgcagcagcaaccccatccgctgtcc
gggtgccgcgcgcccctgaccctgggccacgaattctgcggccaggtcctggccgtcggc
ccgggcgtggagcaggtgcgggtcggcagccgggtggcggtggagcccgaataccgctgc
ggcgactgccagtactgccacgccggtcagtacaacctgtgccagtccatgggctttatt
ggcctgatgggcgatggcggtttcgccgagcaggtgctggtgccggcctacatgctgcac
ccgctgccggactcggtgagcttcaagcaggccgcggtactggagccggcggcggtggcc
ttccacgcgctgaaccagagccgcctgatggccggcgacagctgcgtggtgttcggcctc
ggccccatcggcctgctgctgatcctgctggcgcgcctgcggggcgtagaacggatcttc
gccgtcgacctcagcccggaacgtaggcggctggccctggatttcggcgcccgggaggtg
ctcgacggccgcgccgccgacctgtcgcaacgcctgcaggaactgagcggtggcgggctc
gacacggccttcgaggccgccggcagccagcagaccctggacctcgccctgcactcgctg
cgcaagggcggcgaggtggtgctggtgggcctgatgggcgaggtcggcttcgatgccttt
cacctggtcaatcgcgaattgcgcctgctcggcagcgtcggttatcgcaacgcctacccg
ccgctgatcgagctgctggccagcggccgcctggacctgacccgcgcggtgacccgctgc
gtgacgctggagcaggcggtggaacacggtttcgaggcgctgctgcgggacaagggccag
atcaaggtgctggtcaatcccaacccatcgctggccaaggcatga

DBGET integrated database retrieval system