KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_38370Help
Entry
PCL1606_38370     CDS       T03768                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00071  Fatty acid degradation
pcz00072  Synthesis and degradation of ketone bodies
pcz00280  Valine, leucine and isoleucine degradation
pcz00310  Lysine degradation
pcz00362  Benzoate degradation
pcz00380  Tryptophan metabolism
pcz00620  Pyruvate metabolism
pcz00630  Glyoxylate and dicarboxylate metabolism
pcz00640  Propanoate metabolism
pcz00650  Butanoate metabolism
pcz00900  Terpenoid backbone biosynthesis
pcz01100  Metabolic pathways
pcz01110  Biosynthesis of secondary metabolites
pcz01120  Microbial metabolism in diverse environments
pcz01130  Biosynthesis of antibiotics
pcz01200  Carbon metabolism
pcz01212  Fatty acid metabolism
pcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCL1606_38370
   00630 Glyoxylate and dicarboxylate metabolism
    PCL1606_38370
   00640 Propanoate metabolism
    PCL1606_38370
   00650 Butanoate metabolism
    PCL1606_38370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PCL1606_38370
   00072 Synthesis and degradation of ketone bodies
    PCL1606_38370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PCL1606_38370
   00310 Lysine degradation
    PCL1606_38370
   00380 Tryptophan metabolism
    PCL1606_38370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PCL1606_38370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PCL1606_38370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PCL1606_38370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcz04147]
    PCL1606_38370
Enzymes [BR:pcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PCL1606_38370
Exosome [BR:pcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCL1606_38370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKA25288
UniProt: A0A0D5Y1S5
Position
4208957..4210135
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLANIPAVDLGAAVIRQLLAQTGLDGAQVDEVIMGQVLTAG
AGQNPARQAAIKAGLPHAVPALTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGQENMSL
ANYVVPGARTGLRMGHSQLTDTMISDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKAVAAIEGGRFADEITPILIPQRKGDPVAFATDEQPRAGTTAEALGKLKPAFKKDG
TVTAGNASSLNDGAAAVILMSAAKAKALGLPVLAKIAAYANAGVDPAIMGIGPVSATRRC
LDKAGWSLDQLDLIEANEAFAAQALSVGQELGWDASKVNVNGGAIALGHPIGASGCRVLV
TLLHEMLKRDAKKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtaatcgttgccgccacccgtaccgcggtcggcagtttccagggttcg
ctggcgaacatccccgcggtcgacctgggtgccgcggtgatccgccaactgctggcccag
accggcctcgacggcgcccaggtcgatgaagtgatcatgggccaggtgctcaccgccggc
gccgggcagaaccccgcccgccaggccgcgatcaaggccggcctgccccacgccgtgccc
gcgctgaccctgaacaaggtctgcggctccggcctcaaggccctgcacctgggcgcccag
gccatccgttgcggcgacgccgaggtgatcatcgccggcggccaggagaacatgagcctc
gccaactatgtagtgcccggcgcccgcaccggcctgcgcatgggccacagccagctgacc
gataccatgatcagcgacggcctgtgggatgccttcaacgactaccacatgggcatcacc
gccgagaacctggtggacaagtacggcatcagccgcgaagcccaggacgccttcgccgcc
gcttcgcagcagaaagccgtagccgccatcgagggcgggcgcttcgccgacgagatcacc
ccgatcctgattccccagcgcaagggtgaccccgtggccttcgccaccgacgagcagccg
cgcgccggcaccaccgccgaagccctgggcaagctcaagccggcattcaagaaagacggc
acggtcaccgccggcaacgcctcgtcgctgaacgacggcgccgccgcggtgatcctgatg
agcgccgccaaggccaaggccctgggcctgccggtgctggcgaagatcgccgcctacgcc
aacgccggggtcgacccggcgatcatgggcatcggcccggtttccgccacccgccgctgc
ctggacaaggccggctggtccctggaccaactggacctgatcgaagccaacgaagccttc
gccgcccaggcgctgtcggtgggccaggagctgggctgggatgcgagcaaggtcaacgtc
aacggcggcgccatcgccctcggccacccgatcggcgcctcgggctgccgggtgctggtg
accctgctgcacgaaatgctcaagcgcgacgccaagaaaggcctcgccaccctgtgcatc
ggcggcggccagggcgtggcgctggccatcgagcgctaa

DBGET integrated database retrieval system