KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_44980Help
Entry
PCL1606_44980     CDS       T03768                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00790  Folate biosynthesis
pcz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCL1606_44980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcz04147]
    PCL1606_44980
Enzymes [BR:pcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PCL1606_44980
Exosome [BR:pcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCL1606_44980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AKA25945
UniProt: A0A0D5Y4H1
Position
4912744..4913100
Genome map
AA seq 118 aa AA seqDB search
MTALNQAHCEACRADAPQVSDEELPVLIKQIPDWNIEVRDGVMQLEKVFLFKNFKFALAF
TNAMGEISEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTDEVAKTAEGRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctctgaaccaagcccactgcgaagcctgccgcgccgatgcccctcaagtcagc
gacgaagaactgccggtactgatcaagcagatccccgactggaacattgaagtccgcgat
ggcgtgatgcagctggaaaaagtcttcctgttcaaaaacttcaaattcgccctggccttt
accaacgcaatgggtgaaatttccgaggcggaaggtcatcatcccggccttctcaccgaa
tggggcaaggtcaccgtgacctggtggagccactccatcaagggcctgcaccgcaacgac
ttcatcatggccgctcgcaccgacgaggtggccaagaccgcagaaggacgcaagtaa

DBGET integrated database retrieval system