KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_51240Help
Entry
PCL1606_51240     CDS       T03768                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00350  Tyrosine metabolism
pcz00643  Styrene degradation
pcz01100  Metabolic pathways
pcz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PCL1606_51240
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PCL1606_51240
Enzymes [BR:pcz01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PCL1606_51240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AKA26571
UniProt: A0A0D5Y5J0
Position
complement(5563923..5564561)
Genome map
AA seq 212 aa AA seqDB search
MELYTYYRSTASYRVRIALALKGLDYQALPVNLLVPAGGANRQPQYLEINPQGRVPALRT
DDGELLIQSLAIIEYLEERYPQVPLLSRELAARAHERAVAMLVCCDIHPLHNSSTQNLLR
QWGYDEARLLEWIGHWIGNGLAAIEQLIGEQGYCFGEQPGLADTCLIPQLYAAERFKVPL
DAYPRIRRVAALAAEHPAFQKAHPANQPDTPA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagctctatacctactaccgctcgaccgcctcctaccgggtgcgtatcgcgctggcg
ctcaagggcctggattaccaggcgctgccggtcaacctgctggtccccgccggcggcgcc
aaccgccagccgcaatacctggagatcaacccgcagggccgggtgccggccttgcgtacc
gacgacggcgagctgctgatccagtcgctcgcgatcatcgagtacctcgaggaacgttat
ccacaggtgccgctgctctccagggaactggcggcccgcgcccacgagcgcgcggtggcg
atgctggtgtgctgcgatatccatccgctgcacaactccagcacgcagaatctgctgcgc
cagtggggctacgacgaggcccggttgctggagtggatcggccactggatcggcaatggc
ctggcggcgatcgaacagctgatcggcgagcagggctattgcttcggtgaacagccgggg
ctggccgacacctgcctgattccccagctgtacgccgcggagcgcttcaaggtgccgctg
gacgcctacccacggatccgccgggtcgcggccctggcggcggaacacccggccttccag
aaagcccatccggccaaccagcccgatacacctgcgtag

DBGET integrated database retrieval system