KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_57990Help
Entry
PCL1606_57990     CDS       T03768                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PCL1606_57990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pcz02022]
    PCL1606_57990
Two-component system [BR:pcz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PCL1606_57990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AKA27244
UniProt: A0A0D5Y8A1
Position
complement(6304185..6304925)
Genome map
AA seq 246 aa AA seqDB search
MSSTAHTAEGEKILIVDDDPGLSSLLERFFVSKGYRARAVPNTEQMDRLLGREVFNLVVL
DLMLPGEDGLTACRRLRSANNQIPIIMLTAKGDELSRIKGLELGADDYLAKPFNPDELMA
RVKAVLRRQSPSVPGAPGSEDENVTFGDYELSLATRELKRGAEVHMLTTGEFAVLKALVM
NARQPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDPSKPRYIQTVWGVGYVFVP
DGTPTK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgcacacactgccgaaggcgaaaaaattctgattgttgacgacgacccg
gggctgagcagcctgctggagcgcttcttcgtcagcaagggctaccgtgcccgcgcggtt
cccaacaccgagcagatggaccgtctgctgggtcgcgaagtattcaacctggtcgtcctc
gacctgatgctgcctggcgaagacggcctgaccgcgtgccgccgcctgcgcagtgccaac
aaccagatcccgatcatcatgctgaccgccaagggcgacgaactgagccgcatcaagggc
ctggaactgggcgccgacgactacctggccaagccgttcaaccccgacgagctgatggcc
cgggtcaaggccgtgttgcggcgccagtcgccttcggtgccgggcgcgccgggcagcgaa
gacgagaacgtcaccttcggcgactacgagctgtccctggccacccgcgaactcaagcgc
ggcgccgaagtgcacatgctcaccaccggcgagttcgcggtgctcaaggcgctggtgatg
aacgcccgccagccgctgacccgcgacaagctgatgaacctggcccgtggccgcgagtgg
gatgccctggagcgttccatcgacgtgcagatctcccgcctgcgccggatgatcgaaccc
gatccgtccaagccgcgttacatccagacggtctggggcgtgggttatgtgttcgtgccg
gatggcacgcccaccaagtga

DBGET integrated database retrieval system